Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Science & Tech
Home›Science & Tech›Integrating coding into chemistry accelerates scientific progress.opinion

Integrating coding into chemistry accelerates scientific progress.opinion

By admin1
August 17, 2022
523
0
Share:

[ad_1]

High-throughput chemists like my team and myself usually see the inefficiencies the most. When a bench chemist takes his 8 his LC-MS samples evenly throughout an average day, he tends to quickly get used to the imperfections of the 20 second workflow and stop complaining. But when a high-throughput chemist processes his 96 samples from a well plate at once, small limitations can add up to become a major annoyance or even a disabling inhibitor. . At some point in my career, I was asked to organize his LC-MS data using a specific workflow. This process involved remoting to multiple computers and performing some lengthy workarounds to combine files and export high-throughput data in batches. We could only export analytical data slowly, so if we later noticed new by-products, we would have to weigh the benefits of identifying by-product yield patterns across plates against the value of the time to re-run the export process. was. The benefits were often not immediate, and information was lost regularly. Everyone knows that if you were designing software, you wouldn’t do it this way. But we were chemists, not software designers.

But a year ago, I tried a free introductory coding course. It was run by an acquaintance I knew from my undergraduate days, but as a chemist who was the first to enter the industry, I thought it would be a great idea to do it in parallel with my work. I didn’t think there was much reason to code it, but it seemed like it could come in handy someday.

i was right By the time I was shown a complex LC-MS workflow, my quickly recalled Python knowledge was limited. But the main thing the course taught me was that it can be done. I googled almost every line until I built It wasn’t well written and didn’t take advantage of many useful open source packages that I was unaware of, but it was enough. The new script meant that my team and I were free to capture any information we identified.

Chemists are in a great position to step into both camps

Since venturing into the broad data, coding, and cheminformatics realms of chemical knowledge, I’ve found it to be a great place, albeit an entirely different community than synthetic chemistry. Overall, data chemists are more adamant about the need to open and drive progress than the already open and progressive pharmaceutical synthetic chemistry community. Beyond chemistry, in the world of data, leading a free public course is a badge of honor, so there are broader efforts to distribute learning for free. This allowed me to start learning while working a full-time chemistry job. But when my organic chemist friend and I attended our first chemical data conference, we realized there was a big cultural difference. We found one of the organizers and by that time the beer was worth it and the three of us went to the pub. Very different from a typical late night at a bar after an organic chemistry conference.

A colleague recently told me: But you don’t actually have to “go” anywhere. Chemists are in a great position to step into both camps, as I did in the beginning. I polled some colleagues as to whether they would be interested in taking his beginner’s Python course, and expected the answers to be mostly negative. Instead, about 80% of them wisely said yes. I’m happy because this makes it easy to use time-saving scripts written by programming experts. We had so many questions about how to start coding that we created a web page of resources so we didn’t have to repeat ourselves 100 times.

But now is the time for me to act. He is heavily involved in synthetic chemistry while transitioning to work on data strategy full-time. My passion for chemical data, code, and workflow is not despite being a synthetic organic chemist, but because. Knowledge of chemistry is also an important strength in this role. Many of us have seen digital lab tools that were apparently created without consulting a lab chemist. With a little cooperation, we can change that. My goal is to do great synthetic chemistry faster and with higher quality, so that chemists not only get more out of their experiments, but also free up their time from doing the things they don’t want to do. is to They should work less, not more! Data chemists are making great strides towards their goal of achieving faster, better science, and I can’t wait to be part of it! not.

[ad_2]

Source link

Tagsbarbeercommunitydayfreefriendhappymemymyselfnewnightorganicpassionrunstrengththetimeworkworld
Previous Article

BresicWhitney, Outsourced Doors & Art Pharmacy

Next Article

This celebrity-beloved fashion brand is the first ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    What are the seven most expensive homes that have sold in East Brunswick in the past week?

    July 1, 2023
    By admin1
  • Fashion

    Pokémon GO Season of Light Fashion Week Event Guide

    September 25, 2022
    By admin1
  • All

    8 proven ways Africans can make money with digital marketing

    May 28, 2022
    By admin1
  • Science & Tech

    Chemical modification of silk proteins formed into shapes and films yields better water repellency than currently available non-stick coatings — ...

    September 23, 2022
    By admin1
  • Health & Beauty

    Declining monkeypox cases make health officials ‘cautiously optimistic’

    August 26, 2022
    By admin1
  • Fashion

    National Charity League, Inc. San Dieguito Senior Recognition and Fashion Show

    September 3, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Political Science, Economics Expert Explains Possible Reasons Behind Current Influx of Asylum Seekers

  • Science & Tech

    Examples of gender-diverse research teams

  • Science & Tech

    Click, Book, Charge: EV Charger Installation Made Simple with Click Mechanic

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Are Two Teachers Better Than One?

    By admin1
    September 13, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy