Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Vom Bildschirm zum Bildschirm: Memmo Bringt Promis Direkt Zu Dir

      July 18, 2025
      0
    • Entdecken Sie die Freude am nahtlosen Reisen: Die Kraft von Deutschlandticket entfalten

      July 10, 2025
      0
    • Wählen Sie die beste Fähre für Ihre nächste Reise: Starten Sie in ...

      July 10, 2025
      0
    • The QHotels Collection – Elegant Escapes, Golf Retreats, and Relaxed Luxury Stays ...

      July 9, 2025
      0
    • Erkunden Sie Europas atemberaubendste Städte bequem und entspannt bei Ihrem nächsten Städtetrip

      July 9, 2025
      0
    • Caesars Rewards – The Ultimate Destination for Gaming, Luxury, and World-Class Hospitality

      July 9, 2025
      0
    • Discover Xcaret: Where Nature, Culture, and Adventure Come to Life

      July 9, 2025
      0
    • One World Observatory: Rise Above, See Beyond, Feel New York Like Never ...

      July 9, 2025
      0
    • Unveiling the Post Office: Unlocking a World of Convenience and Services

      July 9, 2025
      0
  • Fashion
    • Erleben Sie den Luxus von Sisley Paris: Premium-Hautpflege und Make-up für ein ...

      July 11, 2025
      0
    • Empowerment Starts Underneath: The EBY Revolution in Comfort and Purpose

      July 9, 2025
      0
    • Shop Ethical Fashion and Vintage Finds to Support Global Causes While Elevating ...

      July 9, 2025
      0
    • Wear the Change – Explore Comfort and Purpose with EBY Intimates

      June 26, 2025
      0
    • Seamless Confidence – Redefining Everyday Comfort with EBY Intimates

      June 20, 2025
      0
    • Stylish Finds for Little Ones: Shop Pre-Loved Kids' Dresses with Purpose

      June 13, 2025
      0
    • Jeden Kilometer meistern: Laufbar Laufjacke für Herren – Unübertroffener Komfort, Stil und ...

      June 10, 2025
      0
    • Scopri profumi femminili di lusso per ogni stato d'animo e occasione

      June 6, 2025
      0
    • Shop Smart, Dress Sharp: Ethical Superstore Men’s Shirts for a Stylish and ...

      June 4, 2025
      0
  • Health & Beauty
    • Erschließen Sie Ihr Potenzial mit Forever Young: Eine Reise zu Gesundheit und ...

      July 12, 2025
      0
    • Choose the Right Fragrance for You: Top Perfumes That Define Femininity and ...

      July 9, 2025
      0
    • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

      June 12, 2025
      0
    • Verwandeln Sie Ihr Haar mit MiiN Cosmetics: Die ultimative Revolution in der ...

      June 11, 2025
      0
    • Verbessern Sie Ihre Wellness-Routine mit Lucky Hemp CBD Ölen

      June 11, 2025
      0
    • L'ARISÉ Beauty: Entdecken Sie den Reiz von pudriger Eleganz und zeitloser Raffinesse ...

      June 9, 2025
      0
    • Scopri i prodotti delicati per la cura dei capelli e per ottenere ...

      June 8, 2025
      0
    • Trasforma la tua pelle con questi prodotti idratanti essenziali – Sconti speciali

      June 6, 2025
      0
    • Le migliori soluzioni per la cura della pelle: protezione solare e sollievo ...

      June 6, 2025
      0
  • Science & Tech
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Vom Bildschirm zum Bildschirm: Memmo Bringt Promis Direkt Zu Dir

  • Experience Baseball More Than Just a Game: Step Up to the Plate with New York Yankees’ Legendary Fan Experience

  • Ultimate New York Yankees Memorabilia: Show Your Team Pride Today!

  • Feel the Pulse of Baseball’s Greatest Stage: Score Big with New York Yankees Tickets for an Unforgettable 2025 Season

  • Erschließen Sie Ihr Potenzial mit Forever Young: Eine Reise zu Gesundheit und Vitalität

  • Erleben Sie den Luxus von Sisley Paris: Premium-Hautpflege und Make-up für ein makelloses Aussehen

  • Drive Smart, Travel Far – Discover Flexible, Eco-Friendly Car Hire with Europcar Worldwide

  • Europcar – Reliable Car Rentals With Flexible Plans and Hidden Fee Risks

Science & Tech
Home›Science & Tech›Integrating coding into chemistry accelerates scientific progress.opinion

Integrating coding into chemistry accelerates scientific progress.opinion

By admin1
August 17, 2022
348
0
Share:

[ad_1]

High-throughput chemists like my team and myself usually see the inefficiencies the most. When a bench chemist takes his 8 his LC-MS samples evenly throughout an average day, he tends to quickly get used to the imperfections of the 20 second workflow and stop complaining. But when a high-throughput chemist processes his 96 samples from a well plate at once, small limitations can add up to become a major annoyance or even a disabling inhibitor. . At some point in my career, I was asked to organize his LC-MS data using a specific workflow. This process involved remoting to multiple computers and performing some lengthy workarounds to combine files and export high-throughput data in batches. We could only export analytical data slowly, so if we later noticed new by-products, we would have to weigh the benefits of identifying by-product yield patterns across plates against the value of the time to re-run the export process. was. The benefits were often not immediate, and information was lost regularly. Everyone knows that if you were designing software, you wouldn’t do it this way. But we were chemists, not software designers.

But a year ago, I tried a free introductory coding course. It was run by an acquaintance I knew from my undergraduate days, but as a chemist who was the first to enter the industry, I thought it would be a great idea to do it in parallel with my work. I didn’t think there was much reason to code it, but it seemed like it could come in handy someday.

i was right By the time I was shown a complex LC-MS workflow, my quickly recalled Python knowledge was limited. But the main thing the course taught me was that it can be done. I googled almost every line until I built It wasn’t well written and didn’t take advantage of many useful open source packages that I was unaware of, but it was enough. The new script meant that my team and I were free to capture any information we identified.

Chemists are in a great position to step into both camps

Since venturing into the broad data, coding, and cheminformatics realms of chemical knowledge, I’ve found it to be a great place, albeit an entirely different community than synthetic chemistry. Overall, data chemists are more adamant about the need to open and drive progress than the already open and progressive pharmaceutical synthetic chemistry community. Beyond chemistry, in the world of data, leading a free public course is a badge of honor, so there are broader efforts to distribute learning for free. This allowed me to start learning while working a full-time chemistry job. But when my organic chemist friend and I attended our first chemical data conference, we realized there was a big cultural difference. We found one of the organizers and by that time the beer was worth it and the three of us went to the pub. Very different from a typical late night at a bar after an organic chemistry conference.

A colleague recently told me: But you don’t actually have to “go” anywhere. Chemists are in a great position to step into both camps, as I did in the beginning. I polled some colleagues as to whether they would be interested in taking his beginner’s Python course, and expected the answers to be mostly negative. Instead, about 80% of them wisely said yes. I’m happy because this makes it easy to use time-saving scripts written by programming experts. We had so many questions about how to start coding that we created a web page of resources so we didn’t have to repeat ourselves 100 times.

But now is the time for me to act. He is heavily involved in synthetic chemistry while transitioning to work on data strategy full-time. My passion for chemical data, code, and workflow is not despite being a synthetic organic chemist, but because. Knowledge of chemistry is also an important strength in this role. Many of us have seen digital lab tools that were apparently created without consulting a lab chemist. With a little cooperation, we can change that. My goal is to do great synthetic chemistry faster and with higher quality, so that chemists not only get more out of their experiments, but also free up their time from doing the things they don’t want to do. is to They should work less, not more! Data chemists are making great strides towards their goal of achieving faster, better science, and I can’t wait to be part of it! not.

[ad_2]

Source link

Tagsbarbeercommunitydayfreefriendhappymemymyselfnewnightorganicpassionrunstrengththetimeworkworld
Previous Article

BresicWhitney, Outsourced Doors & Art Pharmacy

Next Article

This celebrity-beloved fashion brand is the first ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    Career in Science | Philstar.com

    August 21, 2022
    By admin1
  • All

    Traffic Summit – Stay Ahead of the Digital Marketing Industry

    September 2, 2022
    By admin1
  • All

    Take a look at some of the best franchise marketing companies.

    August 31, 2022
    By admin1
  • Travel & Lifestyle

    School Lunch Payments on Monday’s School Board Agenda – Salisbury Post

    August 21, 2022
    By admin1
  • Health & Beauty

    Top venture capital investors for Health Tech startups

    September 23, 2022
    By admin1
  • Home&LivingTechnology

    Meaco: Your Trusted Partner for Superior Air Purification and Home Comfort Solutions

    August 21, 2024
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Buttons Are Better Than Touchscreens, That’s Science

  • Science & Tech

    Remarks by President Biden on Rebuilding American Manufacturing Through the CHIPS and Science Act

  • Science & Tech

    This camera can snap atoms better than a smartphone

Search

Categories

  • All (1,240)
  • Animal Food (19)
  • Books & Novels (21)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,711)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (16)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,592)
  • Health & Beauty (21)
  • Home&Living (218)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (10)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,346)
  • Science & Tech (1)
  • Sports (27)
  • Technology (157)
  • Travel & Lifestyle (1,652)
  • Travel & Lifestyle (14)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Vom Bildschirm zum Bildschirm: Memmo Bringt Promis Direkt Zu Dir

    By admin1
    July 18, 2025
  • Experience Baseball More Than Just a Game: Step Up to the Plate with New York ...

    By admin1
    July 16, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Top 11 Digital Marketing Agencies in Los Angeles

    By admin1
    June 22, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy