Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Travel & Lifestyle
Home›Travel & Lifestyle›When Student Anxiety Gets in the Way of Attending School

When Student Anxiety Gets in the Way of Attending School

By admin1
September 13, 2023
586
0
Share:

[ad_1]

Since the pandemic, mental health strains on youth have been put in the spotlight.

Pandemic closures provided some students with a chance to notice how stressed they are at school, says Jayne Demsky, founder of School Avoidance Alliance, an advocacy group that provides professional training to schools.

The time away from physical classrooms gave children and teens an experience with which to contrast the regular anxiety of being at school. Now that in-person school is back in session, Demsky argues, schools now have to coax these students back into the building.

“Just like [adults] rethought our work-life balance, and our employers had to treat us kindly and reengage us and to show us why we should work for them — kids are the same,” Demsky says.

Many students are missing school completely, and the number of chronically absent students — defined as those who miss 10 percent or more of the school year — has increased. Since the pandemic, roughly 13.6 million students are chronically absent.

Some share of students missing from school are suffering from school avoidance, sometimes also called school refusal, which is when children experience severe emotional or physical distress about going to school.

These kids might be hiding in the corner crying under their covers, tantruming and glued to their beds, or holding onto a wall, so their parents can’t drive them to class.

— Jayne Demsky

Rather than just a distaste for school, refusal can be visceral.

“These kids might be hiding in the corner crying under their covers, tantruming and glued to their beds, or holding onto a wall, so their parents can’t drive them to class,” Demsky says.

Avoidance has become a crisis in recent years, one that schools aren’t prepared to handle, according to mental health experts. Long term, it can leave students unprepared for life. It can knock students off the traditional developmental path and leave them without crucial social and emotional skills, says Anne Marie Albano, a clinical psychologist with experience in school avoidance. Often, other psychologists who spoke with EdSurge noted, there are underlying conditions that can exacerbate anxiety around school as well.

The strain of mental health woes has ratcheted up pressure on schools to provide support. But schools are stretched thin for mental health staff, with as many as 100,000 more mental health professionals needed around the country.

Some districts have gotten creative. A school district in Virginia even constructed a middle school building with extra glass in the hopes that more natural light will serve as a palliative. But a more common approach has been to ink contracts with telehealth companies.

Still, for families and teachers trying to tackle school avoidance, it can mean that there are few resources for the specialized interventions students need.

There are no clinical diagnostic criteria for avoidance, which takes a different form for each child. But generally, it’s marked by sustained absence, which gets harder to correct the longer the student is out of the classroom, Albano says. Unlike some other forms of absence, it won’t go away on its own but requires intervention that’s tailored to the student and can account for the deeper reasons a student is avoiding school, she adds. Those reasons tend to be highly specific to the individual students, she specifies.

But it’s hard to solve a problem you don’t know about.

Desperate Measures

Many parents have never heard of school avoidance, and educators aren’t comprehensively trained on it, according to activists and health care professionals. Not all clinicians even know how to treat school avoidance. For parents, “It’s scary,” says Demsky of School Avoidance Alliance.

Schools can conflate avoidance with truancy or other forms of absenteeism that fail to consider the anxiety causing it, Demsky says. (Demsky started her organization after her experiences with her own son’s school avoidance, which led the police to her doorstep and left her “on the verge of an emotional breakdown.”)

The nuance can get lost in efforts to get students back in physical classrooms.

Post-pandemic, legislatures have looked to increase penalties for students missing school. Penalties can range from fines to threats of jail time if the parents are found to have failed to get their kids to school. In Texas, for instance, lawmakers proposed hiking up the fines for truancy to cut down on absences earlier this year. It was controversial with family groups for penalizing missed school rather than remedying the root causes.

But treating refusal like truancy makes it harder to solve the problem, according to activists like Demsky. “I’ve spoken to families and they said, ‘hey, if I could pay $500 and go to jail for a week and have my kid get better and go to school, I would do it.’ So that just shows you how desperate families are,” she says.

Instead, Demsky calls for schools to recognize when refusal is occurring, and to follow evidence-based paths. That means psychological evaluations, finding out whether there’s an undiagnosed learning disability that’s making school acutely uncomfortable for the student, and other measures such as exposure therapy, she says.

In the schools she works with, that requires finding “a champion,” someone who has a connection with the student to help draw them back into the school, she says. In that, it’s similar to addressing chronic absenteeism in general, which Hedy Chang, executive director of the nonprofit Attendance Works, says boils down to meaningful relationships.

For beleaguered educators, it’s yet another hat they’re being asked to wear. But for some students, it may be crucial, activists say.

“Schools have to step in and take the place of those missing mental health professionals. And they really have to step up and become the support structure for these families,” Demsky says.

[ad_2]

Source link

Tagscreativedrawfamilyfollowhealthhikinginkkidslifelightmynaturalschoolsharetexasthetimetrainingworkyou
Previous Article

Dear Abby: Can you give me some ...

Next Article

Mark Unveils WhatsApp Channels for Personalized Updates ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    Virginia Tech Carillion School of Medicine’s first medical education lecture honors the late Richard C. Valli. VTx

    September 28, 2022
    By admin1
  • Science & Tech

    25 years of putting climate science into action

    September 30, 2022
    By admin1
  • Science & Tech

    History and Social Sciences – Prince William County Public Schools

    September 13, 2022
    By admin1
  • The B2B marketplace boom has already begun

    August 22, 2023
    By admin1
  • Fashion

    “Avant-garbage” fashion at the CU Museum of Natural History

    September 6, 2022
    By admin1
  • Fashion

    15 fashion discoveries that pass as a designer

    September 22, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Air Force turns focus to future information operations

  • Science & Tech

    Science Reveals Weight Training Habits That Slow Aging — Eat That, Not This

  • Science & Tech

    Science museum celebrates Hispanic heritage

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Dinnerly: Affordable, Delicious, and Effortless Meal Kits Delivered to Your Door

    By admin1
    August 19, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy