Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ultimate Adventure and Sensory Exploration at Xcaret: Your Gateway to Riviera Maya’s ...

      June 13, 2025
      0
    • Thrill Unleashed – Curated Adventure Gifts for the Daring, Bold, and Wild ...

      June 12, 2025
      0
    • Explore New Roads in Comfort and Style with Europcar’s Flexible Vehicle Rental ...

      June 10, 2025
      0
    • The QHotels Collection – Luxury Escapes, Spa Breaks, and Golf Retreats Across ...

      June 10, 2025
      0
    • Caesars Unleashed – Luxury, Luck, and Legendary Escapes Await

      June 9, 2025
      0
    • Europcar Offers the Ultimate Travel Flexibility with a Wide Range of Reliable ...

      June 7, 2025
      0
    • Explore the Best Travel Insurance Options for Every Journey and Travel Type ...

      June 7, 2025
      0
    • Unlocking the Future of Longevity and Healthy Aging with Audiobooks

      June 6, 2025
      0
    • Effortless Car Rental: Making Travel More Convenient and Enjoyable

      June 6, 2025
      0
  • Fashion
    • Stylish Finds for Little Ones: Shop Pre-Loved Kids' Dresses with Purpose

      June 13, 2025
      0
    • Jeden Kilometer meistern: Laufbar Laufjacke für Herren – Unübertroffener Komfort, Stil und ...

      June 10, 2025
      0
    • Scopri profumi femminili di lusso per ogni stato d'animo e occasione

      June 6, 2025
      0
    • Shop Smart, Dress Sharp: Ethical Superstore Men’s Shirts for a Stylish and ...

      June 4, 2025
      0
    • Transform Your Wardrobe with the Unmatched Style of Dresses from WAT THE ...

      June 4, 2025
      0
    • Versatile Dresses for Every Occasion: Sustainable Fashion at Its Best

      June 4, 2025
      0
    • Explore the Best Men’s Shirts for Sustainable Travel and Style

      June 4, 2025
      0
    • Transform Your Daily Look with These Luxe Loungewear Must-Haves

      June 4, 2025
      0
    • Timeless Denim and Relaxed Fits: Discovering WAT THE BRAND’s Essentials

      June 3, 2025
      0
  • Health & Beauty
    • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

      June 12, 2025
      0
    • Verwandeln Sie Ihr Haar mit MiiN Cosmetics: Die ultimative Revolution in der ...

      June 11, 2025
      0
    • Verbessern Sie Ihre Wellness-Routine mit Lucky Hemp CBD Ölen

      June 11, 2025
      0
    • L'ARISÉ Beauty: Entdecken Sie den Reiz von pudriger Eleganz und zeitloser Raffinesse ...

      June 9, 2025
      0
    • Scopri i prodotti delicati per la cura dei capelli e per ottenere ...

      June 8, 2025
      0
    • Trasforma la tua pelle con questi prodotti idratanti essenziali – Sconti speciali

      June 6, 2025
      0
    • Le migliori soluzioni per la cura della pelle: protezione solare e sollievo ...

      June 6, 2025
      0
    • Experience Enhanced Wellness with Zooki’s Cutting-Edge Liquid Supplements Designed for Maximum Effectiveness

      June 6, 2025
      0
    • Satisfy Your Nut Butter Cravings with MyProtein’s Pure, No-Additive Spreads

      June 3, 2025
      0
  • Science & Tech
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Scoprite il futuro dell’informatica con i portatili e le workstation ad alte prestazioni di HP

  • Comprehensive Divorce Guides: How to Secure Your Financial Future During and After Divorce

  • Shop with Purpose: Oxfam’s Creative & Impactful Products

  • Ultimate Adventure and Sensory Exploration at Xcaret: Your Gateway to Riviera Maya’s Best Parks

  • Stylish Finds for Little Ones: Shop Pre-Loved Kids’ Dresses with Purpose

  • Verbessern Sie die Gesundheit Ihres Pferdes mit den natürlichen Premium-Nahrungsergänzungen von EQUIVA

  • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

  • Audible Experience Redefined – Audiobooks, Podcasts, and Endless Stories

Fashion
Home›Fashion›Fashion Prize Announces Top 5 Designer Finalists

Fashion Prize Announces Top 5 Designer Finalists

By admin1
August 18, 2022
270
0
Share:

[ad_1]

Shreveport, Louisiana (KSLA) – The top five fashion award finalists and the announcement of the fashion event for week two of Prize Fest were live streamed.

On September 17th at The Great Raft Brewery, Katie Larson of Agora Borealis joined past winners, supporters and sponsors on the podium to announce the top five designer finalists. Each contestant submitted a fashion design and was judged by experts to determine who would compete on the runway walk on October 16th to determine the winner.

Finalist:

  • Amy Trem Designs
  • real gun key
  • Donna Strebeck
  • Darien O’Neill Designs
  • odAOMO

Larson also announced that the Oct. 16 event will be brunch on Sunday from 10am to 2pm.

There are two types of tickets:

  • General admission including free drinks, full brunch and access to the runway fashion show.
  • VIP includes two complimentary drinks, brunch, access to designers and models, multiple floors of the venue, souvenir bags, stage seating at the runway walk, and more.

To purchase tickets for any Fashion Prize Event or any other Prize Fest event, please visit https://www.eventbrite.com/e/prize-fest-2022-a-film-food-music-fashion-and-comedy- Please access. Festival Ticket – 317357895007

For more information on Prize Fest, please visit https://prizefest.com/fashion/.

Copyright 2022 KSLA. all rights reserved.

[ad_2]

Source link

Tagscomedydesigndesignerdrinkseventfashionfestivalfilmfoodfreelivemusicshowsundaythetopwalk
Previous Article

Colorado Community Health Education Center Receives New ...

Next Article

ISB Executive Education to Accelerate Professional Digital ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Elevate Your Style: Must-Have Dresses from Hello Molly

    August 27, 2024
    By admin1
  • Fashion

    Diller’s Fashion Gala Celebrates Opening at Amarillo Westgate Mall

    September 17, 2022
    By admin1
  • Science & Tech

    Scientists discover new kind of synapse hidden in mouse brain : ScienceAlert

    September 3, 2022
    By admin1
  • All

    Jaymie Scotto & Associates (JSA) Ranked Number 3700 in America’s Fastest Growing Private Companies on 2022 Inc. 5000 List

    August 16, 2022
    By admin1
  • Science & Tech

    Science experiments at Tulsa’s Discovery Lab offer a unique way to learn

    September 20, 2022
    By admin1
  • Health & Beauty

    Daily horoscope for July 9, 2023

    July 9, 2023
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Science fun with grandchildren | News

  • Science & Tech

    Political science has a long history of excluding people of color.

  • Science & Tech

    The Kentucky Science Center announces the name of the newly installed World’s Fair Triceratops.news

Search

Categories

  • All (1,240)
  • Animal Food (18)
  • Books & Novels (18)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,702)
  • Fitness & Health (19)
  • Food & Drinks (16)
  • Gift Guides (52)
  • Gift Guides (24)
  • Health & Beauty (1,590)
  • Health & Beauty (21)
  • Home&Living (217)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (8)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,346)
  • Sports (23)
  • Technology (155)
  • Travel & Lifestyle (14)
  • Travel & Lifestyle (1,641)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Scoprite il futuro dell’informatica con i portatili e le workstation ad alte prestazioni di HP

    By admin1
    June 15, 2025
  • Comprehensive Divorce Guides: How to Secure Your Financial Future During and After Divorce

    By admin1
    June 15, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Some local school board members criticize governorship candidate Doug Mastriano’s education plans

    By admin1
    September 26, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy