Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Science & Tech
Home›Science & Tech›Mathematics and Computer Science Students Named to Hacking Top 50 List

Mathematics and Computer Science Students Named to Hacking Top 50 List

By admin1
September 1, 2022
512
0
Share:

[ad_1]

Faris Asshai

Faris Ashai, a math and computer science student at the University of California, San Diego, was named to the MLH Top 50 list. Photo credit: Asshai.

Faris Ashai, a math and computer science student at the University of California, San Diego, was recently featured in the 2022 Major League Hacking (MLH) Top 50. MLH compiles this list each year, featuring the most inspiring members of the hackathon community, recognizing the tech ecosystem and his contributions to STEM education. Hackathons are software, small hardware, or app development sprints for computer programmers, often over the weekend. It’s not hacking into sensitive cyber domains that might come to mind.

Ashai was recognized for creating new opportunities to make the hackathon community more inclusive and accessible. As the organizer and director of her TritonHacks, her annual 30-hour hackathon for high school students at the University of California, San Diego, Asshai provides industry mentors for each participant, regardless of skill level, and novices. We provided participants with a highly effective starter her kit.

A high school student attends the Triton Hux opening ceremony.

A high school student attends the Triton Hux opening ceremony. Photo courtesy of Triton Hacks.

Nick says: “It is a tremendous honor to be selected as an MLH Top 50 winner, each from a pool of over 150,000 active community members, one in three new programmers in the US (and Internationally there are many more),” said Quinlan, MLH Chief Operating Officer. “Being selected means your work is recognized in the top 10 of today’s top 10 percent of new techs.”

In this Q&A, learn more about Ashai’s decision to study math and computer science at UC San Diego, his involvement on campus, and how the skills he learned through the hacking community will help him in his future role.

Q. Why did you choose to major in mathematics and computer science?

A. I decided to pursue mathematics and computer science majors because it seemed like an interesting balance between my two interests. I’ve always been interested in math, and when I took my first coding class in my sophomore year of high school, I quickly realized that it was something I wanted to pursue for my career. What was really interesting about looking at the options for a major at UC San Diego was that I was able to dive deep into higher division courses in both subjects without committing to a full double major course load. After completing core classes, you can now choose electives that interest you. I found the right overlap where my interdisciplinary knowledge helped me to be more successful than my individual majors.

TritonHacks participants work on their projects during a 30-hour hackathon.

TritonHacks participants work on their projects during a 30-hour hackathon. Photo courtesy of Triton Hacks.

Why did you choose UC San Diego?

A. I’m from Los Angeles, so I wanted to stay on the west coast by the beach in nice weather, and UC San Diego was perfect for me because of all the great engineering programs available and the beautiful city!

What activities have you been doing on campus? How has UC San Diego helped you improve your hacking skills?

A. I first learned of the existence of a student organization called the Association for Computing Machinery (ACM) at an event called Engineers on the Green during my freshman year at the University of California, San Diego (just a few months after its founding). After joining the company, I found an amazing community of students passionate about computing topics and engineering, and saw countless opportunities to step out of my comfort zone to develop new technical skills, leadership experience, and communication skills. Through friends in this organization, I became more involved with the Hackathon his community and another team in the group CS foreach. The team organized a high school hackathon and later served as director of this one year. Through countless hackathons as a participant, I’ve always been inspired to compete and improve myself with the friends he’s found at UC San Diego.

How will the skills you learn through the hacking community help you in the future? What career are you interested in?

UC San Diego students volunteer at TritonHacks.

UC San Diego students volunteer at TritonHacks to provide technical support and guidance to high school participants. Photo courtesy of Triton Hacks.

A. I wouldn’t have been where I am today without participating in the hackathon community. My first use of React, a popular front-end web development framework, was in a second hackathon project called ResReview. I have continued to use this framework for several hackathons and have seen significant improvement as I become more familiar with the skills I learned to build products quickly in a team environment. I think that’s one of the biggest reasons I got it. I am using these same skills daily in my current internship and will likely be using them for years to come.

What do you want to do after graduation?

A. I am currently planning to go into software engineering after graduation and am excited to delve deeper into this. But I also think it would be interesting to eventually move into a more product management role to gain broader influence over the products I’m working with.

share



[ad_2]

Source link

TagsamazingbeachbeautifulcaliforniacitydailyfriendsgreenmemynewniceperfectphotoschoolshareTechtopweekendwork
Previous Article

How a 22-year-old ‘digital nomad’ travels the ...

Next Article

Lincoln Company Strengthens Online Presence

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    Urban teenagers face unequal access to inclusive education

    September 25, 2022
    By admin1
  • Travel & Lifestyle

    Education is more than just training

    September 11, 2022
    By admin1
  • Health & Beauty

    Imminent hospital closures disrupt Atlanta’s healthcare environment, political competition

    September 15, 2022
    By admin1
  • Health & BeautyTechnology

    Obtenez une coiffure de qualité professionnelle à la maison avec les sèche-cheveux et les appareils de coiffure Shark

    December 12, 2024
    By admin1
  • All

    Influence Agencies Ranked Top 100 in The Globe and Mail’s “Top Growing Companies in Canada” Report

    September 27, 2022
    By admin1
  • Fashion

    New York Fashion Week Spring/Summer 2023 Street Style Checks So Many Trends

    September 11, 2022
    By admin1

You may interested

  • Science & Tech

    SCSU Political Science Chair Discusses Poll Challenges

  • Science & Tech

    Space Force wants ‘sustained’ satellite mobility by 2028

  • Science & Tech

    Is Ontario’s COVID Science Table About to Be Shut Down? It certainly looks like it

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • IIT Roorkee and Imarticus Learning Team Up to Launch Advanced Certification in Digital Marketing and ...

    By admin1
    August 17, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy