Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Travel & Lifestyle
Home›Travel & Lifestyle›Does ‘Toxic Gratitude’ Harm Latino Educators in the Workplace?

Does ‘Toxic Gratitude’ Harm Latino Educators in the Workplace?

By admin1
August 2, 2023
477
0
Share:

[ad_1]

This is the third in a three-part series of conversations with Latino educators and edtech experts. Read the first part here and the second part here.

Before we get into the educator perspectives shared below, there’s something I have to explain about Latino culture. Something perhaps not exclusive or applicable to the way all 62.5 million of us in the United States were raised, but important for context just the same.

I learned you can’t put all your eggs in one basket and then think, ‘Because I submit to this, even though I don’t agree to it, I’m gonna be fine.’

— Cindy Noriega

Many of us will remember a time when we complained to a parent or elder about our job — too little pay for too many hours, a terrible co-worker, feeling something was unfair — and were met with a response that was some version of, “Thank God there’s work for you.”

There’s a belief in Latino culture that we should be grateful for whatever our boss is willing to give us and never ask for more, no matter how bad things get. It would be worse to make waves and risk getting fired.

This way of thinking has been dubbed “toxic gratitude” or self-gaslighting, and the pressure immigrant children feel to help improve their family’s economic circumstances has been called “toxic stress.”

This scarcity mindset — that there’s not enough opportunity to go around, and so you just have to make do — has to be unlearned, usually when you’re older and realize that you don’t want to work for peanuts or spend every day at a bad workplace or get passed over for another promotion.

When I recently invited a panel of Latino educators and edtech experts to share their perspectives about the state of education, they specifically wanted to talk about this cultural belief of “just be grateful” and how it impacts their work.

Here’s what they had to say.

‘No.’ Is a Complete Sentence

Math and computer science teacher Cindy Noriega kicked the conversation off.

“I went on a 10-minute rant about this yesterday, so I was ready for this question,” she said, earning laughs from the audience listening to the panel.

Noriega explains that she feels guilty anytime she wants to push back against a school administrator. It’s an internal struggle that she feels is firmly rooted in her upbringing as the daughter of Mexican immigrants. She recalls her hectic first year at a California high school, where she was overloaded with a full teaching schedule of four different subjects.

“I didn’t have a free period, and I was scared to say ‘no,’” Noriega says. “There’s that sense of, ‘You need to be content where you’re at.’ The way my parents put it to me, ‘We came to this country for a better life. Now that you’re a professional, just be happy where you’re at and be thankful and always be submissive to your bosses regardless of what they’re asking.’”

Noriega says her mentality changed after last year when she took on some work she didn’t want in hopes it would reflect well on her and save another classroom resource that was on the chopping block.

“Well, guess what? It still got taken away,” she says. “That’s why I learned you can’t put all your eggs in one basket and then think, ‘Because I submit to this, even though I don’t agree to it, I’m gonna be fine.’”

Like the saying goes, “No.” is a complete sentence. Noriega no longer feels guilty about advocating for herself in the workplace, even if it means disagreeing with an administrator, and she hopes other Latino educators can get to the same place.

“If not, we’re just gonna be shackled to this concept and just live in fear and live in this weird area where we’re content but at the same time not happy,” she says, “and I don’t want that for Latinos. I don’t want that for anyone, period.”

Uncomfortable Spotlight

Rocío Raña has spent a lot of time pondering this question of why she feels pressure to “just be grateful.” She was scrolling through social media recently when she came across a headline from her alma mater in New York that made her pause. It was about a Black graduate from the university who landed a tenure track position after his first interview.

The write-up didn’t sit quite right with Raña, who felt like the article’s tone was bordering on disbelief.

She recalled how two white women in her own Ph.D. graduating class also landed tenure track positions after their first and only interviews, but those situations didn’t make a headline.

“It’s like, ‘Oh, because you’re Black, you have to be grateful.’ Because you’re Latino, ‘Oh, wow, on your first interview,’” says Raña, who co-founded an edtech company that creates assessments for bilingual children. “People get that all the time when they are white, and they don’t make a headline. So there’s an expectation of gratitude from minoritized communities, but not from everybody.”

That’s not to say Raña isn’t grateful for the things in her life — her family and friends, for example, or the opportunity she had to come to the U.S.

“But it’s the expectation that the system has on certain communities, and it’s a way of keeping us down somehow, I feel,” she says.

If you’re not intentionally building, we are in danger of replicating structures that haven’t been successful for anybody.

— Edward Gonzalez

Worked to Exhaustion

To understand Antonio Vigil’s perspective, you have to start with a classic piece of literature by Herman Melville.

“So you might think it odd that a Chicano from North Denver would quote and invoke ‘Bartleby, the Scrivener,’” Vigil, director of innovative classroom technology at Aurora Public Schools in Colorado, says. “But Bartleby the scrivener is this cat in literature who refuses to go to work and refuses to work.”

Not a cat like “meow.” Bartleby is a human man and clerk hired by the story’s narrator, a lawyer. Bartleby likes to respond to his boss’s requests that he get to work with, “I would prefer not to.”

It’s an analogy, Vigil says, for the relationship between oppressed communities and how their value is based on how much they work.

“We literally have to work ourselves to death to prove our value and our worth to exist and enjoy semblance of rights, responsibilities, and privilege in this country,” Vigil says, “and so I think what’s really problematic is the way in which not only oppressed communities like Latinos are forced — and in many ways mandated and coerced — into many of these roles and positions that we know that we could occupy differently if given the proper opportunity and equitable opportunity.”

The irony is that every immigrant community has identified with having a back-breaking work ethic, Vigil says. But he feels that toiling has dovetailed with Latinos becoming a “permanent working class,” one that doesn’t make decisions and doesn’t have the “cultural and intellectual capital to drive change.”

“I think the big shift that we need to make is that we have to stop seeing ourselves as renters and see ourselves as owners,” he says. “How do we become better caretakers and builders of community so that we are not tirelessly expecting every generation to take its rightful place in the world by dying in the workplace because of exhaustion?”

Building a Bigger Table

As a Hispanic man from California, being in the state’s ethnic plurality brings with it some privileges, says Edward Gonzalez, director of open educational resources for the Kern County Superintendent of Schools in California. Not every space is one where Latinos are expected to be grateful for the positions they’re in, he explains, or feel as though they’ve had to overcome an oppressive system.

In fact, Gonzalez explains, there are times when Hispanic educators find that the people throwing up barriers to their growth look a lot like them.

“Where it gets difficult for me is when I see that same [oppressive] system set up, but it’s Latinos who are pushing that structure down onto other Latinos who are coming up behind them,” he says.

Thinking back to both his experiences as a student and educator, Gonzalez says, it was primarily Black and white women who offered him mentorship. He wants to pay forward their support to other educators, regardless of background.

“How do I not replicate that system where I’m only looking out for a Hispanic man or ensuring that that’s only what’s gravitating to me?” he says. “I do that by looking out for other students that I see that need that mentorship, recognizing that there’s some communities that will never have the privilege that I have now” of being surrounded by people who share his culture.

“If you’re not intentionally building,” he adds, “we are in danger of replicating structures that haven’t been successful for anybody.”

[ad_2]

Source link

Tagsblackcaliforniacatdayenjoyfamilyfriendshappylifelikeslivelookmemynewquotewhitewomenworkworld
Previous Article

Black Literature Gave Me the Freedom to ...

Next Article

2023 Summer Tech Boot Camp for Kids

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    How to Be Human: Lessons Learned from the South Side Science Festival

    October 15, 2022
    By admin1
  • All

    Holitech Solutions Announces Specialized Digital Marketing Services and More Latest News

    August 19, 2022
    By admin1
  • Science & Tech

    From Paper to Cloud: Transforming Your Accounting with Xero

    March 2, 2024
    By admin1
  • Health & Beauty

    Health policy experts issue new challenge to Berwick and Gilfiran

    August 16, 2022
    By admin1
  • Fashion

    ‘And Just Like That’ Season 3: All The Fashion Looks We’ve Seen So Far

    May 22, 2024
    By admin1
  • Home&Living

    Elevate Your Drinking Experience: SMWS and the Best in Craft Spirits

    November 27, 2024
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    When should I get the flu vaccination?

  • Science & Tech

    Ukraine says UFOs are all over the country

  • Science & Tech

    Science Talk – World Cancer Research Day: How International Collaboration Can Help the Global Cancer Research Community

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (52)
  • Gift Guides (23)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • People in Your Neighborhood: La Jolla Teen Code Teaches Computer Science to Underprivileged Students

    By admin1
    September 1, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy