Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Fashion
Home›Fashion›‘And Just Like That’ Season 3: All The Fashion Looks We’ve Seen So Far

‘And Just Like That’ Season 3: All The Fashion Looks We’ve Seen So Far

By admin1
May 22, 2024
386
0
Share:

[ad_1]

Below, we’re breaking down every look we’ve seen so far.

By
Katherine Singh

Date May 22, 2024

If there’s one thing Carrie Bradshaw is known for, it’s taking a fashion risk. From donning a belt over her bare midsection to rocking a wedding crown that would make an evil queen jealous, Carrie was the OG “I dress for myself” gal. Some of her Sex and the City ensembles were hits (like this sleek grey minidress/aviators combo), and some were misses (like this *ahem* memorable capris tie-dye moment). The same back-and-forth can be said for her fashion looks in Max’s reboot And Just Like That…, which has officially begun filming for season 3.

Over the past two seasons, fans have watched as Carrie and her BFFs Miranda Hobbes (Cynthia Nixon) and Charlotte York (Kristin Davis) have adjusted to life as middle-aged New Yorkers. The Sex and the City spinoff has shown them navigating love, loss, and menopause — all while donning new designers and pulling from wardrobes that seemingly defy the square footage of a New York City closet.

With legendary SATC costume designer Patricia Fields no longer deciding the outfits for the characters, however, some of the crew’s formerly quirky style has just been a straight-up miss. (Need we remind everyone of Aidan’s season 2 Edward Scissorhands jacket or Carrie’s rubber gloves/kerchief moment?). Much like Miranda’s storyline in the reboot, some of the fashion seemed to be truly out of character for our heroines. But maybe that was kind of the point.

The first two seasons of the series were tumultuous for Carrie et al., with Carrie recovering and finding herself after the death of her husband Big early on in season 1. But now, Miranda (after a divorce, a new relationship, and a leap back into school) has finally found her footing, and Charlotte is back to being the A+ mom she’s always been. Season 3 will seemingly find the trio and their new friends at the top of their games, so it makes sense that the characters would come into their sense of style, too.

And no one seems to be doing that more than Carrie. Early photos from the And Just Like That… season 3 set have featured Sarah Jessica Parker in a bevy of chic of-the-moment fashion ‘fits, and we’re officially obsessed.

Kicking off with a Carrie classic silhouette, the first day of filming found the lead in a mint-coloured vintage YSL blouse, and pink vintage Ralph Lauren Skirt, paired with matching mint Aquazzura heels and a studded Gucci bag.

On May 20, costume designer Danny Santiago shared a photo of Parker on-set rocking a vintage Ossie Clark dress in merlot, pinks and blues. Carrie strut through the streets in a pair of Dr. Scholl’s (gasp!) sandals and — the real pièce de résistance, an oversized brown gingham cloud hat. Not only is Carrie’s chapeau over the top in the best way, it also has a fun Canadian connection, designed by Tehran-born and Toronto-raised artist Maryam Keyhani.

Only a day later, Parker was spotted again on set in a nude sheer Simone Rocha dress and matching parka from the brand’s Spring 2024 collection. Because this is the world of SATC, it wasn’t just any regular dress but a sheer creation with pressed roses in the sleeves and pockets. Art!

Outside of SJP, other superb looks have been spotted on Charlotte’s school friend Lisa Todd Wexley (played by Nicole Ari Parker). On May 13, Santiago shared a photo of Parker’s character in a multicoloured vintage Dior blouse, black YSL heels, and black-and-white sunnies from Maryam Keyhani (again!).

The magic fashion factor that makes these And Just Like That… season 3 looks work — specifically when it comes to SJP — is the balance of classic with just the right amount of quirk. The get-ups pair simple silhouettes with pops (like Carrie’s aforementioned amazing hat) and bring in a mix of classic and more of-the-moment designers.

The result, at least so far, has been ‘fits that are to-die-for and somewhat easily replicable. Above all, though, they’re looks we actually want to replicate (because no way would you catch us trying to pass of a pair of rubber cleaning gloves as street style accessories).

Dare we say…Sex and the City‘s sartorial reign is officially back? Time will tell.

More TV & Movies

Style

By
Annika Lautens

Date May 16, 2024

Style

By
Natalie Michie

Date May 8, 2024

Style

By
Katherine Singh

Date May 1, 2024



[ad_2]

Source link

Tagsamazingartartistblackdressfashionfriendsfunlifelooklovenewphotopinkspringstylevintageweddingworkworld
Previous Article

Early Educators Deserve Better, Starting With Health ...

Next Article

Modest Fashion Is the Star At 2024 ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Tekashi69 could pay up to $350,000 in Fashion Nova lawsuit

    September 21, 2022
    By admin1
  • Health & Beauty

    FDA moves to make hearing aids available over-the-counter

    August 16, 2022
    By admin1
  • Travel & Lifestyle

    DeSantis Fires Broward Board of Education Staff Following Parkland Report

    August 27, 2022
    By admin1
  • Travel & Lifestyle

    Utah School Board Seeks Opinion After Decisive Debate on Student Health and Risk Prevention Survey – St. George News

    September 28, 2022
    By admin1
  • Books & Novels

    The Timeless Appeal of Gaming Magazine Subscriptions for Enthusiasts

    November 27, 2024
    By admin1
  • Travel & Lifestyle

    How Schools Are Coaching — or Coaxing — Teachers to Use ChatGPT

    August 3, 2023
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Here’s how to repair the Pentagon’s CAPE office

  • Science & Tech

    The Science of It: Making a Ring Toss

  • Science & Tech

    BioInnovation Institute supports three international start-ups developing pioneering science in therapeutics and health technologies

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • All the Best Looks From Toronto’s Naomi x BOSS Celebration

    By admin1
    February 27, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy