Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
    • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys ...

      August 12, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

  • Un’assicurazione di viaggio affidabile per una vacanza all’estero senza preoccupazioni

All
Home›All›Holitech Solutions Announces Specialized Digital Marketing Services and More Latest News

Holitech Solutions Announces Specialized Digital Marketing Services and More Latest News

By admin1
August 19, 2022
386
0
Share:

[ad_1]

A company called Holitech Solutions claims to start with cutting-edge technology and use a unique digital marketing strategy for guaranteed results.

KARACHI, Sindh, Pakistan, Aug. 20, 2022 /EINPresswire.com/ — Holitek Solutions, a division of Holitek Consulting, today announced the launch of its full-service digital marketing offering. This new service offers website design and development, social media marketing, search engine marketing, SMS marketing, YouTube advertising, videography services, and SEO services to businesses of all sizes.

Yazdan Ali, CEO of Holitech Solutions said: “Our digital he marketing agency in Karachi provides businesses with the tools and expertise they need to reach and engage their target audience online.”

Website design and development

Holitech Solutions provides custom website design and development services tailored to each client’s specific needs and goals. Our team of experienced web developers will work with you to create visually appealing and easy-to-navigate websites. It also has all the features you need.

social media marketing

Holitech Solutions provides comprehensive social media marketing services to help you reach and engage your target audience on the most popular social media platforms. We develop and implement a social media strategy that aligns with your business goals, helping you create and share content that resonates with your audience.

search engine marketing

Holitech Solutions provides search engine marketing services that help you reach your target audience through major search engines. Develop and implement search engine optimization strategies designed to improve your visibility and ranking in search results and increase traffic to your website.

sms marketing

Holitech Solutions offers SMS marketing services to help you reach and engage your target audience via text messages. Develop and implement SMS marketing strategies designed to promote your products and services and drive more sales and leads.

YouTube ads

Holitech Solutions provides YouTube advertising services that help you reach your target audience through videos. Develop and implement a YouTube advertising strategy designed to promote your brand and increase traffic to your website or channel.

video shooting service

Holitech Solutions provides videography services that help you create high quality videos for your website or channel. Our team of experienced videographers create professional and engaging videos to help promote your business.

SEO service

Holitech Solutions offers SEO services in Karachi and nationwide to help improve your website’s visibility and ranking in search results. Develop and implement SEO strategies designed to improve website optimization and increase visibility in search results.

For inquiries and reservations, please visit the Holitec Solution official website.

About Holitech Solutions

Horitech Solutions is a digital agency located in Karachi, Pakistan. We offer a wide range of digital services to help businesses grow online.

Our services include SEO, social media marketing, email marketing, web design and development, and branding. We have a team of experts who are passionate about helping businesses succeed online.

Our motto is to be close to each customer and to provide the best possible service.

Visit our website or contact us at +92344-2331081.

Yazdan Ali
Holitech Solutions
+92 344 2331081
email here
Visit us on social media:
Facebook

you just read:

news source

19 Aug 2022 21:23 GMT


EIN Presswire’s priority is source transparency. We do not allow opaque clients and our editors take care to remove false or misleading content.
As a user, if you find something I missed, please let me know. Your help is greatly appreciated. EIN Presswire, Everyone’s Internet News Presswire™,
I try to define some of the boundaries that are reasonable in today’s world.Please look
Editorial guidelines
for more information.

Submit press release

Holitech Solutions Announces Professional Digital Marketing Services and Latest News Updates

I thought I’d let you all know Today’s Latest News 2022 You will love all this news very much because through this website you will always have all the news that we offer in this news.It’s a trending topic and whatever the latest news

What you keep getting has always been our effort to reach you Electrical News, Degree News, Donation News, Bitcoin News, Trading News, Real Estate News, Gaming News, Trending News, Digital Marketing, Telecom News, Beauty News, Banking News, Travel News, Health news, Cryptocurrency News, Claims News Latest news and you always keep getting information of news free through us and also tell people to you.

Holitech Solutions Announces Specialized Digital Marketing Services and More Live News

All this news I made and shared for you, you will love it.Obtainable

We bring you the latest and greatest news for free so that you can stay informed on the news and move forward.will follow later

Provide information about details world news update today We will always keep you up to date with the latest news and make sure that whatever information comes to hand, it will be communicated to everyone.

Holitech Solutions Announces Specialized Digital Marketing Services and More News Today

With all this news, or information, that I bring to you will be the most different and best news that your people get nowhere Trending News, Breaking News, Health News, Science News, Sports News, Entertainment News, Technology News, Business News, World News We’ve made this available to everyone so you can stay connected with the news, stay ahead of issues, and stay informed news of the day Get all kinds of news for free today so you get news by getting it.always take two steps

Credits go to news website – The news website of this original content owner.This is not my content so if you want to read the original content you can follow the link below

Click here for the original link 🡽



[ad_2]

Source link

TagsbeautybestBusinessdaydesignfollowgoalshealthlivelovemarketingmemynewsharetravelvideoworkworldyoutube
Previous Article

Holitech Solutions Launches Specialized Digital Marketing Services

Next Article

UVA Health provides updates on COVID-19-related hospitalizations

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    Fierce Nevada gubernatorial race brings Republican challenger Lombardo into education

    September 17, 2022
    By admin1
  • Science & Tech

    Ezra Minard and Casey Science Lead Marietta Boys to Victory at Fort Fly | News, Sports, Jobs

    September 11, 2022
    By admin1
  • All

    Digital Marketing Ranks Top 3 Hottest Skills Americans Will Learn in 2022

    July 6, 2022
    By admin1
  • Health & Beauty

    Bile Duct Cancer Treatment and Mental Health – Cleveland Clinic

    August 23, 2022
    By admin1
  • Travel & Lifestyle

    Back to School: Education On Parenting From A Distance | Rivkin Radler LLP

    September 2, 2022
    By admin1
  • Fashion

    The Biggest 2023 Viral Moments in Fashion

    December 12, 2023
    By admin1

You may interested

  • Science & Tech

    Army faces logistics, alliance hurdles in the Pacific

  • Science & Tech

    Are facts always true?A philosopher explains how to tell the difference

  • Science & Tech

    How DC Comics’ failure changed sci-fi and fantasy forever

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (17)
  • Travel & Lifestyle (1,754)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Are facts always true?A philosopher explains how to tell the difference

    By admin1
    September 24, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy