Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›Rabies Potential Warning – updated 16 September

Rabies Potential Warning – updated 16 September

By admin1
September 17, 2022
469
0
Share:

[ad_1]

Update posted on September 16, 2022

On September 16, 2022, North Dakota Health and Human Services (HHS) was notified that the raccoon identified in connection with the Maddock Bar incident had tested negative for rabies.

HHS issued a statement on the situation on September 13, 2022. At the time, the raccoon’s whereabouts were still under investigation.

“When humans and animals such as raccoons come into contact with each other, there is no choice but to consider possible exposure to rabies. Amanda Bakken said.

“For domestic dogs, cats and ferrets, the duration of viral shedding is well understood to allow for observation periods to rule out exposure to rabies. Unfortunately, in most other mammals, the virus The duration of emissions is not well understood.Reliable observation period.”

For additional information about animal rabies activity in North Dakota, visit ndhealth.gov/disease/rabies.

Originally posted on September 13, 2022

The North Dakota Health and Human Services (HHS) has notified the public of the situation in Maddock, North Dakota, which may have contracted rabies. A captured raccoon was brought into Maddock’s bar on Tuesday, September 6th. Anyone who may have been bitten by a raccoon or come into contact with raccoon saliva should consult a health care provider as soon as possible about the potential danger. Rabies exposure. “Rabies is a very serious disease with a fatality rate of almost 100%, so we are sharing this information with the public as a precautionary measure,” said HHS epidemiologist Amanda Bakken.

Rabies is a viral infection that infects mammals, including humans. In the United States, the virus circulates in wildlife and is most commonly found in bats, raccoons, skunks, coyotes and foxes. Rabies wildlife can transmit rabies to unvaccinated cats, dogs and domestic animals, posing a threat to people.

Viruses are most often transmitted through the bite of an infected animal. Rabies can also be transmitted if saliva or nervous system tissue from a rabid animal gets into a cut, wound, eye, nose or mouth. The virus attacks the nervous system and causes swelling in the brain. There is no cure and rabies is almost always fatal.

“If you’ve been bitten by an animal, you should seek medical attention as soon as possible,” Bakken said. “If the animal is a healthy dog, cat or domesticated ferret, it should be confined and observed for 10 days to rule out transmission of the rabies virus. If a wild animal bites you, its Animals should be euthanized and tested for rabies.

HHS recommends the following precautions to reduce the risk of rabies:

  • Do not keep wild animals as pets. Keeping raccoons and skunks as pets is illegal in North Dakota.
  • Keep feral and wild animals, especially skunks, away from your pets and livestock.
  • Keep your dog, cat, ferret and horse rabies vaccinations up to date. Your veterinarian can advise you on the latest vaccination recommendations.
  • Don’t leave uncovered trash or pet food outside, as it can attract wild and stray animals to your home and garden.
  • Stay away from unfamiliar or wild animals.
  • Learn how to avoid animal bites. Be especially careful with children. Teach children not to handle or approach unfamiliar animals without the permission of a parent or guardian and the animal’s owner.
  • Report any stray or unusual behavior to your local animal control agency.
  • Protect your home from bats to prevent bats from nesting in your home and getting close to people and pets.
  • Avoid contact with animals while traveling, especially when traveling internationally.

In 2022, 6 cases of rabies have been reported in North Dakota, including 2 bats, 2 cats, 1 cow and 1 skunk. For additional information about animal rabies activity in North Dakota, visit ndhealth.gov/disease/rabies.

[ad_2]

Source link

Tagsanimalanimalsbarcatcatsdogdogsfoodgardenhealthhealthyhomehorsepeoplepetpetstimetravelingviralwildlife
Previous Article

Pingree Sponsors Bill Aimed at Ensuring Equity ...

Next Article

Tacoma Police Chief Says Education Is Key ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Buying GuidesBuying GuidesFashionGift GuidesGift Guides

    Elevate Your iPhone 16 with CASETiFY’s Stylish and Protective Cases

    September 16, 2024
    By admin1
  • Health & Beauty

    Medical costs may help explain link between multiple sclerosis and latitude ScienceDaily

    August 25, 2022
    By admin1
  • Travel & Lifestyle

    Here are the education items for the November election ballot

    August 23, 2022
    By admin1
  • Science & Tech

    Minister of Education, Culture, Sports, Science and Technology Igor Papich attends the Science, Technology and Society Forum in Kyoto from ...

    October 10, 2022
    By admin1
  • All

    A survey reveals the 20 most influential people in digital marketing.Digital

    September 14, 2022
    By admin1
  • Health & Beauty

    Germany vs Morocco FREE LIVE STREAM (24/07/23): Watch the Women’s World Cup 2023 online | Time, TV, channel

    July 24, 2023
    By admin1

You may interested

  • Science & Tech

    Steve’s Science: How to Escape Rip Currents

  • Science & Tech

    Today’s D Brief: F-16s cleared for Ukraine; US-Japan-S.Korea summit; Spies target space firms; Deadly days in Tripoli; And a bit more.

  • Science & Tech

    ‘I see no happy ending’, former intelligence leader says of Gaza hostage situation

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (17)
  • Travel & Lifestyle (1,755)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Maryland TODAY | What You Need to Know for Fall 2020: Mental Health…

    By admin1
    September 1, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy