Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

      May 18, 2025
      0
    • Travel in Style and Comfort with Europcar’s Wide Range of Premium Vehicles

      May 18, 2025
      0
    • From Business Trips to Scenic Escapes – Europcar Delivers Every Time

      May 18, 2025
      0
    • Experience Seamless Mobility Across Continents with Europcar’s Global Fleet

      May 18, 2025
      0
    • Unlock Limitless Travel Possibilities with Europcar’s Flexible Rental Solutions

      May 18, 2025
      0
    • Unwind in Style: Discover the Luxury and Charm of the QHotels Collection ...

      May 15, 2025
      0
    • Experience The Heart Of The City Through Cutting-Edge Interactive Technology

      May 15, 2025
      0
    • Enjoy Seamless Luxury and Excitement at Caesars Rewards Most Prestigious Vegas Locations

      May 15, 2025
      0
    • Discover Top Campgrounds Near Iconic National Parks for the Ultimate Outdoor Adventure

      May 11, 2025
      0
  • Fashion
    • L'ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

      May 18, 2025
      0
    • Erhöhen Sie Ihr Schuhspiel: Herren-Barfußstiefel von Groundies

      May 15, 2025
      0
    • Treten Sie ein in die Welt minimalistischer Barfußschuhe für ultimative Freiheit und ...

      May 15, 2025
      0
    • Luis Trenker Kleider: Entworfen für Frauen, die sich trauen, aufzufallen

      May 14, 2025
      0
    • Laufen bei jedem Wetter: Entdecken Sie die besten Laufjacken bei Laufbar

      May 14, 2025
      0
    • Laufen mit Komfort und Stil: Entdecken Sie die besten Laufschuhe bei Laufbar

      May 14, 2025
      0
    • Améliorez votre condition physique avec Myprotein : Les meilleures ventes de vêtements ...

      May 10, 2025
      0
    • Elevate Your Wardrobe with Fruugo: A Vast Selection of Women’s Shoes for ...

      May 8, 2025
      0
    • Enhance Your Golf Game and Style with Premium Men’s Headwear from Discount ...

      May 5, 2025
      0
  • Health & Beauty
    • L'ARISÉ Damenduftkollektion: Eleganz in jeder Note

      May 19, 2025
      0
    • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

      May 19, 2025
      0
    • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

      May 19, 2025
      0
    • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

      May 18, 2025
      0
    • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

      May 18, 2025
      0
    • Fitness Trifft Innovation: Die Speediance Revolution Beginnt Jetzt

      May 15, 2025
      0
    • Erleben Sie die Kraft natürlicher Inhaltsstoffe in den MiiN-Körpercremes

      May 15, 2025
      0
    • Vom Bauernhof zur Verpackung: Das Engagement von Lucky Hemp für hochwertige CBD-Blüten

      May 15, 2025
      0
    • Verbessern Sie Ihre Hautpflege mit den Premium-Gesichtsseren von MiiN

      May 15, 2025
      0
  • Science & Tech
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
    • Revolution beim Kochen im Freien: Rüsten Sie sich mit Ration1.de Essentials

      December 23, 2024
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

  • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

  • Explore Casetify’s Durable and Customizable iPhone 16 Pro Max Cases

  • Camif : Solutions de mobilier durable pour des espaces de vie élégants et fonctionnels

  • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

  • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

  • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

Buying GuidesBuying GuidesFashionGift GuidesGift Guides
Home›Buying Guides›WISKII: Fashion Meets Function for the Modern, Active Lifestyle

WISKII: Fashion Meets Function for the Modern, Active Lifestyle

By admin1
September 2, 2024
240
0
Share:

Elevate Your Activewear Game with WISKII

The WISKII Active is unique because it offers the best athletic wear performance and fashionable athleisure wear to enable individuals achieve their fitness goals. To make clothes that are comfortable, durable, and fashionable, WISKII collaborates with popular textile companies such as LYCRA and NILIT, proving their commitment to development.

Made from ultra-stretchy, silky fabrics that hug the body’s contours, each piece is constructed with focus on the shaping of the body. In as much as they are trendy apparels, WISKII designs are specifically created for high energy activities such as yoga, surfing or any sporting activity.

This is evident where they pay a lot of attention to the quality of the outfits they wear; they tried on numerous outfits to arrive at the best fit for them. Such mentality reflects WISKII’s mission of becoming a leading brand for athletic wear that fosters confidence and uniqueness with the help of comfortable and fashionable clothing.

Effortless Style Meets Performance: WISKII Skirts & Dresses

WISKII’s skirts and dresses are a perfect example of the type of clothing that active women of the present-day society go for because they are functional. Made with gentle precision and made from easy to wear, light and airy fabrics, these pieces can easily be worn on a daily basis and during more active pursuits.

The technological benefits of the skirts and dresses are the same as those found in the activewear line and has simple silhouettes that hug the body. Whether it is a yoga class, a lunch with friends or a trip on the weekend, WISKII offers dresses and skirts which will help you look stylish and feel comfortable.

These pieces are versatile and should be a part of your wardrobe because you can wear them to the gym, casual out. Whether it is a formal meeting, a casual day at the office or running errands, WISKII’s high-performance skirts and dresses will ensure you look and feel great all day. The passion of the brand to offer fashionable clothes has always been retained since the start.

Discover the perfect combination of fashion and function with WISKII’s skirts and dresses. Designed for versatility and comfort, these pieces transition seamlessly from workouts to everyday wear, ensuring you stay chic and confident wherever your day takes you.

Beyond Denim Dress

When denim comes in contact with flounces and metal, the sentimental feeling of the material turns into chic and the power of elegance. WISKII therefore demands for a rebranding of denim, where denim can transform the hard coded perceptions of stiffness and thickness to the best that it can be.

• Vintage grey A-line denim jumper skirt
• Flounce hemline
• U-shape neckline
• Padded bra
• Built-in shorts
• Central metal zipper
• High-waist design

WISKII Future Playground Dress

When white is combined with black lines and zipper, this classic and rather non-conventional dress helps you stand out. This WISKII style makes your beauty more dazzling, and the distinctive design with protection short style makes a movement as you want to, you should not miss this dress!

  • Ivory A-line flounce hemline dress
  • Round-neckline with a short black belt design
  • The unique smooth zipper adds skirt highlights
  • Classic black line waist belt design tank collar dress
  • Super soft fabric to four-way stretch to minimize chafing
  • 2-in-1: Featuring removable pads and siamese shorts for protection

WISKII Pleated Skirt

Score both on and off the basketball court with their WISKII PLEATED SKIRT from their TRUE PACE collection. The perfect addition to everyones wardrobe, this skirt has built in control top, moisture wicking shorts, soft mid rise, elastic waistband and double layer pleats that cross just above the left leg to give that extra little something to your game. Functional and stylish wear this skirt with any WISKII top for the complete look.

• WISKII NUDE SENSATION fabric
• 4-Way stretch that moves with you
• High-rise & hits above mid-thigh,14” length
• Colour: Ivory White, Black, Muted Khaki, Ballet Blush, Belair Blue, Pure Vanilla, Surf, Forest, Cinnamon, Misty Forest, Olive Green, Dawn, Winterpear
• The model is 5’8”- she wears size S

High-Waist A-line Tennis Skirt

Skirts lover? Fitted tennis skirt which is a high-waist A-line skirt with comfortable inner briefs is here to help you conquer the tennis court or the trail running. Designed & uniquely fit due to its back length being longer by 0. 78inch/ 2cm larger than the front to provide extra protection, so you don’t have to worry about it while exercising. Matching your favourite sports bras and tops perfectly.

  • Comfy inner short
  • High waist & hits at upper thigh
  • Colour: Trending Colors
  • Length(S/M/L): front-35/37/39cm, back -37/39/41cm
  • Length(S/M/L): front-13.77”/14.56”/15.35”, back -14.56”/15.35”/16.14”
  • The model is 5’9”, with a 33” bust, 24” waist & 36” hips – she wears size S

Lavish Laser Cut Zip Dress

This Lavish Laser Cut Zip Dress is fashionable and risk-taking to the bone. The laser-cut detailing is well done and if well done, it will give it a unique texture that everyone will admire. Zipper closure that gives the pants a well fitted and smooth look on the figure of the wearer. This dress is a perfect combination of the style of the present days and the strict classic, which will attract attention in any formal or even informal event.

  • High, mock neck
  • Hits above upper thigh
  • Sleeveless Front zip
  • Removable push-up pads
  • Laser-cut & cutout back details
  • Without inner short
  • Light-medium support

Elevate Your Everyday Look with WISKII Skirts & Dresses

Last but not the least, the skirts and the dresses of WISKII are the best example of how the brand is dedicated to merging the fashion with the functionality. These are fashionable and versatile to be used in any task because of the new technology fabric that has been used to enable the fabric to stretch and bend with the body.

One of the advantages of WISKII is that you can wear one of the many skirts or dresses for workout and then for other activities because they can easily transition to casual wear. The commitment of WISKII to assist women to feel comfortable, stylish and well dressed in all aspects of their lives is reflected in the apparels that the business sells, which are meant to promote performance and style.

Experience the perfect blend of style and functionality with WISKII’s skirts and dresses, designed to move with you through every part of your day. Whether for a workout or a casual outing, these versatile pieces keep you looking chic and feeling comfortable.

TagsbeautyblackblueBusinessdailydesignfashionfitfitnessfriendsgymlifestylelookmodelnewstyletripvintageweekendworkout
Previous Article

Euroflorist: Lyft varje tillfälle med utsökt blomsterelegans

Next Article

Casetify: Where Your MacBook Meets Artistry and ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Lil Nas X Curates a Coach Collection + More Fashion News

    December 22, 2023
    By admin1
  • Fashion

    Paris Jackson turned heads at the Missoni fashion show with a total of 180 see-through dresses from normal looks

    September 24, 2022
    By admin1
  • Fashion

    Avril Lavigne KILLSTAR Collection Interview

    August 29, 2022
    By admin1
  • All

    Digital marketing firm AdCounty Media plans to expand to over 50 countries and hire 100 professionals across the industry

    September 10, 2022
    By admin1
  • Fashion

    Fashion Week is back in Pokémon GO.

    September 22, 2022
    By admin1
  • Science & Tech

    Herrmann Leads Architecture and Construction Science Division as Interim Associate Head

    August 25, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Tradefeedr Appoints Former Citi Alexis Fauth as Head of Data Science and Client Analytics

  • Science & Tech

    B-21 takes flight, heads to Edwards AFB for more tests

  • Science & Tech

    Political Science, Economics Expert Explains Possible Reasons Behind Current Influx of Asylum Seekers

Search

Categories

  • All (1,238)
  • Animal Food (17)
  • Books & Novels (14)
  • Buying Guides (22)
  • Buying Guides (32)
  • Donation and Services (6)
  • Export Test (21)
  • Fashion (1,690)
  • Fitness & Health (17)
  • Food & Drinks (15)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,575)
  • Health & Beauty (20)
  • Home&Living (206)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (3)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,344)
  • Sports (21)
  • Technology (150)
  • Travel & Lifestyle (5)
  • Travel & Lifestyle (1,609)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

    By admin1
    May 19, 2025
  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

    By admin1
    May 19, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • MetroPlus Health Plan: COVID-19 Subscriber Trends

    By admin1
    September 1, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy