Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ultimate Adventure and Sensory Exploration at Xcaret: Your Gateway to Riviera Maya’s ...

      June 13, 2025
      0
    • Thrill Unleashed – Curated Adventure Gifts for the Daring, Bold, and Wild ...

      June 12, 2025
      0
    • Explore New Roads in Comfort and Style with Europcar’s Flexible Vehicle Rental ...

      June 10, 2025
      0
    • The QHotels Collection – Luxury Escapes, Spa Breaks, and Golf Retreats Across ...

      June 10, 2025
      0
    • Caesars Unleashed – Luxury, Luck, and Legendary Escapes Await

      June 9, 2025
      0
    • Europcar Offers the Ultimate Travel Flexibility with a Wide Range of Reliable ...

      June 7, 2025
      0
    • Explore the Best Travel Insurance Options for Every Journey and Travel Type ...

      June 7, 2025
      0
    • Unlocking the Future of Longevity and Healthy Aging with Audiobooks

      June 6, 2025
      0
    • Effortless Car Rental: Making Travel More Convenient and Enjoyable

      June 6, 2025
      0
  • Fashion
    • Stylish Finds for Little Ones: Shop Pre-Loved Kids' Dresses with Purpose

      June 13, 2025
      0
    • Jeden Kilometer meistern: Laufbar Laufjacke für Herren – Unübertroffener Komfort, Stil und ...

      June 10, 2025
      0
    • Scopri profumi femminili di lusso per ogni stato d'animo e occasione

      June 6, 2025
      0
    • Shop Smart, Dress Sharp: Ethical Superstore Men’s Shirts for a Stylish and ...

      June 4, 2025
      0
    • Transform Your Wardrobe with the Unmatched Style of Dresses from WAT THE ...

      June 4, 2025
      0
    • Versatile Dresses for Every Occasion: Sustainable Fashion at Its Best

      June 4, 2025
      0
    • Explore the Best Men’s Shirts for Sustainable Travel and Style

      June 4, 2025
      0
    • Transform Your Daily Look with These Luxe Loungewear Must-Haves

      June 4, 2025
      0
    • Timeless Denim and Relaxed Fits: Discovering WAT THE BRAND’s Essentials

      June 3, 2025
      0
  • Health & Beauty
    • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

      June 12, 2025
      0
    • Verwandeln Sie Ihr Haar mit MiiN Cosmetics: Die ultimative Revolution in der ...

      June 11, 2025
      0
    • Verbessern Sie Ihre Wellness-Routine mit Lucky Hemp CBD Ölen

      June 11, 2025
      0
    • L'ARISÉ Beauty: Entdecken Sie den Reiz von pudriger Eleganz und zeitloser Raffinesse ...

      June 9, 2025
      0
    • Scopri i prodotti delicati per la cura dei capelli e per ottenere ...

      June 8, 2025
      0
    • Trasforma la tua pelle con questi prodotti idratanti essenziali – Sconti speciali

      June 6, 2025
      0
    • Le migliori soluzioni per la cura della pelle: protezione solare e sollievo ...

      June 6, 2025
      0
    • Experience Enhanced Wellness with Zooki’s Cutting-Edge Liquid Supplements Designed for Maximum Effectiveness

      June 6, 2025
      0
    • Satisfy Your Nut Butter Cravings with MyProtein’s Pure, No-Additive Spreads

      June 3, 2025
      0
  • Science & Tech
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ultimate Adventure and Sensory Exploration at Xcaret: Your Gateway to Riviera Maya’s Best Parks

  • Stylish Finds for Little Ones: Shop Pre-Loved Kids’ Dresses with Purpose

  • Verbessern Sie die Gesundheit Ihres Pferdes mit den natürlichen Premium-Nahrungsergänzungen von EQUIVA

  • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

  • Thrill Unleashed – Curated Adventure Gifts for the Daring, Bold, and Wild at Heart by Adrenaline

  • Verwandeln Sie Ihr Haar mit MiiN Cosmetics: Die ultimative Revolution in der koreanischen Haarpflege

  • Verbessern Sie Ihre Wellness-Routine mit Lucky Hemp CBD Ölen

  • Law Made Simple – Empower Your Legal Journey with Nolo’s DIY Tools

Health & Beauty
Home›Health & Beauty›Wilmington man rides 15,000 miles to raise mental health awareness among veterans

Wilmington man rides 15,000 miles to raise mental health awareness among veterans

By admin1
August 14, 2022
308
0
Share:

[ad_1]

Wilmington, North Carolina (WECT) – A journey that took almost three months across 48 states and over 15,000 miles has been completed.

Army veteran Perry Steed was back in Wilmington with his family and more than 60 bikers and fellow veterans on Sunday.

The journey, which he calls “Ride for Light,” began on May 20, taking Steed across the continental United States. His purpose was to pick up the remains of two of his comrades-in-arms who took their own lives after serving his country. One was in Parkers Prairie, Minnesota, and his other was in San Luis Obispo, California.

Steed says the mission was to collect the remains and spread them out on the sacred sands of Fort Bragg’s Sicily Drop Zone.

Along the way, he says he learned some valuable lessons when sharing stories with people.

“Every time I tell my story, every time I talk to someone, you absorb some of their pain and sorrow. When I spoke to some of the people who inspired me, they just said I should try a little harder to live in the moment and pay attention to what’s around me. .

Steed has his own organization called Operation: Purpose to spread awareness about veterans struggling with mental health issues.

When Steed first arrived and turned the corner at Paul’s Place, Steed’s family was waiting for him.

“We are a team and the kids adore their father. , I wanted to encourage you to make this trip,” said Steed.

Liz says the look on the children’s faces when their father arrived was irreplaceable.

It was perfect. Our middle child taught us exactly how hard and how long to squeeze them. They are indeed counting down the days. said Steed

Among the bikers and veterans who warmly welcomed Steed was Jason Gilbert. Gilbert and his wife have been friends with the Steed family for several years, and Gilbert says it was heartwarming to show support.

“It’s inspiring to see people care. And how many people actually care,’ said Gilbert.

Steed has a message for his comrades-in-arms who have the same problem.

“My advice to others who are veterans looking at this is to speak up and reach out to your combat comrades because some of the best help I have received on this trip has been my friends, my For the first time in 20 years, we are drawing strength from each other,” Steed said.

Copyright 2022 WECT. All rights reserved.

[ad_2]

Source link

Tagsarmybestcaliforniafamilyfriendshealthkidslightlivelookmanmemypeopleperfectstrengthsundaythetimetrip
Previous Article

Kate Wills reveals her secret for getting ...

Next Article

Hinman Named Director of AAAS DoSER Program

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    The Science of It: Coffee

    August 18, 2022
    By admin1
  • Science & Tech

    Central and Eastern European pressure improved Ukraine’s outcome at NATO summit, experts say

    July 16, 2023
    By admin1
  • All

    Social Neeti Wins Digital Mandate for Legendary Mughlai dine den Shiraz

    September 5, 2022
    By admin1
  • Fashion

    Amelia’s Closet Hosts Project ReStyle Fashion Show and Competition

    August 30, 2022
    By admin1
  • Fashion

    London Fashion Week Spring-Summer 2023: Touching tributes and a rallied community

    September 22, 2022
    By admin1
  • Fashion

    Elevate Your Wardrobe with the Season’s Hottest Dress Trends

    November 28, 2024
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Army’s hyperconnected visions depend on new approaches to software, networks

  • Science & Tech

    US, Japan, South Korea sign pact amid ‘deteriorating’ regional security

  • Science & Tech

    Two Colorful Science Experiments | Deccan Herald

Search

Categories

  • All (1,240)
  • Animal Food (18)
  • Books & Novels (14)
  • Buying Guides (22)
  • Buying Guides (32)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,702)
  • Fitness & Health (19)
  • Food & Drinks (16)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,590)
  • Health & Beauty (21)
  • Home&Living (216)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (8)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,345)
  • Sports (23)
  • Technology (155)
  • Travel & Lifestyle (14)
  • Travel & Lifestyle (1,641)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ultimate Adventure and Sensory Exploration at Xcaret: Your Gateway to Riviera Maya’s Best Parks

    By admin1
    June 13, 2025
  • Stylish Finds for Little Ones: Shop Pre-Loved Kids’ Dresses with Purpose

    By admin1
    June 13, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Can Wolves Bond With Humans Like Dogs? | | Chemistry

    By admin1
    September 20, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy