Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Fashion
Home›Fashion›Weird Perfume Is Taking the Fragrance World by Storm

Weird Perfume Is Taking the Fragrance World by Storm

By admin1
October 25, 2023
598
0
Share:

[ad_1]

Graphics via Adobe Stock

Forget common fragrance notes like rose, vanilla and patchouli. Isabel B. Slone explores a growing trend in the world of perfumery: scents that are, well, kind of gross.

By
Isabel B. Slone

Date October 25, 2023

Courtney Rafuse loves the smell of rot. The Toronto-based perfumer has been mixing up spicy, skunky potions for her brand, Universal Flowering, since 2016. Rafuse is known for creating challenging scents that contain notes of blood (cleverly described as “copper wire accord”) and sweat. Reviewers have described her fragrances as smelling like “Barbie in the microwave.” Yet despite their prominent elements of filth and decay, Universal Flowering perfumes are considered anything but fetid. Rafuse once received an Instagram DM from a customer recounting how a new lover was so smitten by her scent that he proceeded to lick every inch of her body.

Universal Flowering is part of a new and growing guard of perfume brands that have begun to incorporate unconventional notes into their wares. But the world of fragrance is no stranger to ingredients of unsavoury provenance. Take, for instance, ambergris — harvested from the intestines of a whale — which has been used in perfume since the 10th century. Or civet oil, a secretion derived from the perineal gland of a civet cat that features a mind-controlling parasite called Toxoplasma gondii, which has been used in perfume for hundreds of years. (It was one of the main notes in Chanel No. 5 until the brand switched to a synthetic version in 1998.) But common notes like vanilla, amber and rose are increasingly being replaced by uncanny bouquets of semen, ashes, cocaine, plastic and flesh.

Historically, perfume is based on the premise of covering up unpleasant bodily smells and replacing them with something sweet and seductive. But in recent years, perfume itself has begun to get down and dirty and embrace the downright abject. While Thierry Mugler’s Mugler Cologne, which contains an “S” note widely rumoured to be sperm, launched back in 2001, there is now a profusion of similar scents on the market. Brands like Marlou Paris traffic in the scent of bodily secretions, Wolf Brothers produces animalic scents with names like Bear, Goat and Boar and niche brand Akro bottles the scent of vices like alcohol and cigarettes.

Perfume is about storytelling. Every story has to have contrasting elements of darkness and lightness.

“Back in the day, a little bit of naughtiness was good for balancing a gardenia or a tuberose, but now it has kind of flipped and there’s less floral and more funk,” says Callum Rory Mitchell, the nose behind Perdrisat, an Australian small-batch-perfume brand founded in 2022. For a scent called Fuck Boy, Mitchell was inspired by the acrid chemical smell of cocaine to turn the cloying pina colada scent given off by the typical Australian fuckboy into something a little bit nastier. It wasn’t intended to be louche but, rather, a character sketch of a relentless partygoer. “Perfume is about storytelling,” he says. “Every story has to have contrasting elements of darkness and lightness.”

Despite their use of off-putting ingredients, the perfumers creating these unique scents aren’t aiming for an end product that smells horrific; in fact, it’s quite the opposite. In her landmark essay “The Powers of Horror,” Julia Kristeva notes the fine line between arousal and disgust. The abject “is something rejected from which we do not part.”

The curiosity driving this rank-smelling renaissance is due in part to #PerfumeTok, which opened the floodgates for an entirely new audience to get into the previously insular world of perfume, and in part to the legions of new fans desiring more complexity in their bouquets. “I think people’s noses are getting a little more sophisticated and adventurous in general,” says Alana May Johnson, an L.A.-based librarian and fragrance fan.

Historically, the perfume world, which is expected to grow to $49.2 billion by 2029, has been led by big names like LVMH, Coty and L’Oréal. Now, an increasing market share is being snapped up by a burgeoning wave of niche noses who brew perfume like it’s bathtub gin. Indie perfumers aren’t restricted by the same constraints as their conglomerate counterparts and have the freedom to create scents that are more outré and experimental. “A lot of traditional perfumers will say ‘I grew up in the south of France, surrounded by beautiful flowers.’ Those aren’t my childhood memories. I grew up in Missouri playing with pyrotechnics,” says Mark Sage of Clandestine Laboratories, whose Wendover scent is meant to smell like a “damp basement.”

Ultimately, the role of perfume has shifted from being a normal part of a beauty routine to an artistic medium and a form of self-expression. It’s no longer about smelling sweet; it’s about showing who you are to the world, whether that’s macabre, saccharine or anything in between.

“I like leaning into the stinkier sides of a flower — the parts that are a bit pissy or bodily or sexy — to not just make perfume pretty but make it feel more alive,” says Rafuse. Besides, if we can’t completely rid ourselves of grime, perhaps the next best thing to do is embrace it. Perfumes that contain taboo elements offer us a chance to celebrate our inherent humanity — with all the filth and transcendence contained therein.

This article first appeared in FASHION’s November 2023 issue. Find out more here.

[ad_2]

Source link

Tagsbeautifulbeautybestboycatdayfashionflowerflowersfranceinstagrammemoriesmynewparisprettysketchsweettrendworld
Previous Article

How X-Bow plans to break the Northrop-Aerojet ...

Next Article

Why I Believed Edtech Could Save My ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    We can work on health insurance costs

    August 22, 2022
    By admin1
  • Fashion

    Mercedes-Benz Prague Fashion Week Highlights-Xinhua News Agency

    September 4, 2022
    By admin1
  • Travel & Lifestyle

    We Don’t Have to Sacrifice Joy for Rigor in the Classroom

    September 27, 2023
    By admin1
  • Fashion

    Burks Puppies Take the Runway at New York Fashion Week | Homepage Top Stories

    September 16, 2022
    By admin1
  • Travel & Lifestyle

    Teachers and families are more divided than ever – and students are losing

    June 28, 2023
    By admin1
  • Fashion

    KNWLS SS23 Combines Punk and Playful at London Fashion Week

    September 18, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    The Science Behind Captivating Title Credits

  • Science & TechTechnology

    Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

  • Science & Tech

    Master science with this silly invention science kit.Now 45% off

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Generation USA has partnered with St. Louis Community College on the Digital Marketing Analyst Program.your ...

    By admin1
    August 22, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy