Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›Therese Coffey scraps promised paper on health inequalities.Therese Coffey

Therese Coffey scraps promised paper on health inequalities.Therese Coffey

By admin1
September 29, 2022
451
0
Share:

[ad_1]

Therese Coffey is scrapping the government’s long-promised white paper on health disparities despite a 19-year difference in life expectancy between the rich and the poor, The Guardian said.

The Health Secretary has decided not to release a document that would have developed a plan to address the severe inequalities in health exposed by the Covid-19 pandemic.

It appeared by last spring and was meant to be a key part of then-Prime Minister Boris Johnson’s declared mission to level Britain up. and BAME populations, to initiate ‘bold action’ to narrow the widespread inequalities in health outcomes that exist between the north and south of England.

“Dead. Won’t appear. The white paper is in the can,” said a source familiar with the situation.

Another source with knowledge of Coffey’s intentions said:My understanding of why they pulled it is [that it’s] Ideology — The white paper is an insult to this government’s view of what makes health. ”

Health experts were disappointed that the white paper was destroyed. “The government expects to maintain its commitment to addressing health inequalities in future white papers and would be gravely concerned if this long-planned white paper were delayed or shelved.” said Dr Habib Naqvi, director of the NHS Race and Health Observatory.

“We need to identify priorities and action plans to address the many serious and long-standing health inequalities. Especially given the cost of living crisis and its impact on diverse communities, this is It should be a priority.”

Coffey’s decision follows the Truss government’s existing measures to tackle the obesity crisis, such as a buy-one-get-one-free offer and a ban on junk food ads that air on television before 9 p.m. and the decision to consider planned measures. The plan sparked a huge backlash, with former Conservative Party leader William Hague, dozens of health agencies and 26 former health ministers all publicly criticizing it as unwise and dangerous.

The then health secretary, Sajid Javid, told parliamentarians on February 2 that he would publish a white paper on “health disparities” “in the spring of 2022.” It will help address “unacceptable disparities in health outcomes” and “sever the link between people’s backgrounds and prospects for healthy living.”

But it’s been nearly eight months and it still hasn’t appeared. In May, he said it would appear “soon” and address issues “for too long that have been neglected”, such as the shortage of GPs working in poor neighborhoods.

In June, he said the white paper was an important part of his “vision for the coming year”. resigned and set off a chain of events that was succeeded by Liz Truss, who made Coffey deputy prime minister. Minister.

Start your day with top US stories and must-read articles of the day across the Guardian

Privacy Notice: The newsletter may contain information about charities, online advertising and content funded by external parties. For more information, privacy policy. We use Google reCaptcha to protect our website and Google. privacy policy and terms of service application.

The government pledged to move forward with the white paper when it issued another white paper on leveling up earlier this year. But there was a notable omission in the new 14-page Our Patient Plan to Improve the NHS that Coffey released last week.

“Health is closely linked to income, housing, education, employment and our environment. To level up, we need sustained national policy action involving all branches of government,” said Jim McManus, president of the Association of Public Health Commissioners.

William Roberts, CEO of the Royal Society for Public Health, said: “It is with great disappointment to hear that the White Paper on Inequality has been destroyed. It was a clear opportunity to tackle inequality, which has continued to rise over the past two years and has been exacerbated by the cost of living crisis.To restore the health and wealth of the country and rebuild the economy, we need to address this issue now. It is imperative that we work.”

DHSC has been contacted for comment.

[ad_2]

Source link

Tagscommentdayeducationenglandfollowsfoodfreehealthhealthylifemynewpartypeoplespringthetopviewwhitework
Previous Article

Earth Science Week 2022 Toolkit Available

Next Article

Agilent Launches Partnership with Delaware State University ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    Texas Nonprofit Leads Students Through Educational Success – NBC 5 Dallas-Fort Worth

    August 26, 2022
    By admin1
  • Travel & Lifestyle

    ‘Babel’ is a fierce criticism of racism in education | Culture

    September 19, 2022
    By admin1
  • Travel & Lifestyle

    ISU College of Education Awarded $500,000 Scholarships to 621 Students

    August 29, 2022
    By admin1
  • Fashion

    Look of the Week: Zendaya Becomes Fashion’s Flower Girl at Prerelease Loewe

    September 21, 2022
    By admin1
  • All

    E-Impact Marketing Named 14 Clients to 2022 Inc.’s 5000 Fastest Growing Companies List

    August 17, 2022
    By admin1
  • Travel & Lifestyle

    A survey of public school concerns points to significant benefits for charters.education

    August 28, 2022
    By admin1

You may interested

  • Science & Tech

    Agilent Launches Partnership with Delaware State University to Promote Diversity in Science, Technology, Engineering and Mathematics (STEM) Fields

  • Science & Tech

    Creator of Johns Hopkins COVID tracker wins US top science award | Coronavirus pandemic news

  • Science & Tech

    Klinger gains experience in medical laboratory science

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • 50 million tons of water vapor from Tonga eruption could warm Earth for years

    By admin1
    September 24, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy