Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›State laws are thwarting HHS efforts to improve LGBTQ health

State laws are thwarting HHS efforts to improve LGBTQ health

By admin1
June 22, 2024
586
0
Share:

[ad_1]

To foster a healthier future for all Americans, the U.S. Department of Health and Human Services has launched Healthy People 2030. This ambitious and important plan outlines key goals to “Build a healthier future for all.”  

Yet recent legislation is turning “all” to “all except LGBTQ,” making it impossible to reach HHS’s goals.

At its core, Healthy People 2030 outlines data-driven national goals across five pivotal social determinants of health: healthcare access and quality, education access and quality, social and community context, economic stability and neighborhood and built environment.  

While these goals strive to create a society where all can live their healthiest lives, conflicting state legislation — 522 bills introduced in 2024 alone — has severely constrained the program’s use on specific populations, particularly gay, lesbian, and transgender people. These measures pose significant barriers to their health and well-being.  

This legislative action, which has a pronounced focus on transgender individuals potentially affects all five social determinants of health. Here’s how. 

  • Provide access to comprehensive, high-quality health care services. Research highlights the urgent need to address health disparities for sexual and gender minority populations, including increased insurance coverage for relevant healthcare needs. But recent bills, such as Mississippi’s 2023 HB1125, stand to widen this gap by targeting transgender youth health care. Currently, 105,200 transgender youth — about one-third of all U.S. transgender youth — reside in states that ban access to gender-affirming care. Among those who saw a healthcare provider within the last 12 months, nearly half (48 percent) reported experiencing at least one negative incident because they were transgender, including being refused healthcare, being misgendered, encountering harsh or abusive language from providers or experiencing physical roughness or abuse during treatment.  
  • Increase educational opportunities and help children do well in schools. The 2023 legislative session introduced new laws and policies that do not help all youth do well in school. Gender and sexually diverse students are facing unique challenges. Policies in K–12 schools that restrict classroom discussions around specific sexual topics, commonly termed “Don’t Say Gay” laws, have been passed in states such as Florida, Iowa and Arkansas. Laws that silence, exclude, and exacerbate shame around students’ sexual orientation and gender expression can lead sexual and gender minority youth to develop negative mental health and increased depression. These issues affect their academic performance and school engagement, creating worse outcomes.  
  • Increase social and community support. To date, four states have passed legislation asserting that “in human beings, there are two, and only two, sexes: male and female.” This contributes to a hostile social and community environment. Transgender and nonbinary people often struggle with social acceptance. The enactment of this legislation establishes them as less than human beings, makes nonbinary and transgender individuals invisible and excludes them as valuable and meaningful members of society. Research shows that news about anti-transgender legislation and perceived support for such legislation has negative impacts on transgender youth and young adults, including physical health issues, depressive symptoms and fear of disclosing one’s identity. In addition, nearly one in three sexual minority youth report their mental health is poor most of the time or always due to such policies and legislation.  
  • Help people earn steady incomes that allow them to meet their health needs. Currently, 12 percent of the LGBTQ population lives in states with no policy prohibiting discrimination in public employment based on sexual orientation or gender identity. At the federal level, Title VII of the federal Civil Rights Act prohibits discrimination based on sex in employment, and in June 2020 the Supreme Court extended that to include sexual orientation and gender identity. Yet 16 states and two territories have not affirmed this extension nor added additional protections through state-level laws. Research suggests that LGBTQ young adults adjust their career plans because of identity-related challenges at work, contributing to labor market segregation and financial disparities between LGBTQ and other workers. Research shows that bisexual women and transgender individuals experience higher rates of poverty than their peers.  
  • Create neighborhoods and environments that promote health and safety. In Mississippi and Utah, legislation targets bathroom access and usage, creating physical, structural environments that further marginalize transgender individuals. Increases in such policies correlate with increased violence, which in turn contributes to a sense of safety. According to research, transgender and gender-nonconforming youth feel unsafe in bathrooms, which has led to significantly lower resilience and quality of life and greater levels of perceived stigma and problematic anxiety. This sets them up on a path of future negative mental and physical health outcomes. In general, transgender individuals who experience discrimination using a public bathroom have higher rates of attempting and completing suicide. Furthermore, the interpersonal stigma they experience in public spaces is associated with poor health outcomes.

It is 2024, and the clock is ticking. We can make progress in achieving Healthy People 2030’s bold and inclusive agenda for improving health and well-being across the United States. But first, we need to stop enacting legislation that bars the way. 

Maria Valenti is a senior research scientist and behavioral health expert at Education Development Center, a global nonprofit organization to improve education, promote health and expand economic opportunity.

[ad_2]

Source link

Tagschildrencommunityeducationfloridafocusgaygoalshealthhealthylifelivenewnewspeopleschoolthetimewomenwork
Previous Article

Pentagon background-check systems at risk of hacking, ...

Next Article

Swifties take over Wembley… AGAIN! Taylor Swift ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    ‘Tomato Girl Summer’ Is About Dressing For the Life You Don’t Have

    July 25, 2023
    By admin1
  • Science & Tech

    40 science and technology parks to be established in Iran within 5 years

    August 30, 2022
    By admin1
  • Fashion

    Learn more, brand growth stats and more – WWD

    August 15, 2022
    By admin1
  • All

    88% of UK businesses are currently struggling to grow

    August 21, 2022
    By admin1
  • Health & Beauty

    Michigan health officials have set a goal of vaccinating 4 million people against the flu this season

    September 23, 2022
    By admin1
  • Fashion

    Career Focused Fashion Show for Students – Roar of the Lions

    September 22, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    South Plains College opens new science center, changes name

  • Science & Tech

    US plans to publish government-funded scientific research papers • The Register

  • Science & Tech

    Inside the World of Espionage: The SPYSCAPE Experience

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (52)
  • Gift Guides (23)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Army aims to cut 32,000 billets over five years, including 3,000 in special operations

    By admin1
    February 27, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy