Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

All
Home›All›LG Donates Solar-powered Borehole To Gudu Community In Abuja For World Water Day

LG Donates Solar-powered Borehole To Gudu Community In Abuja For World Water Day

By admin1
March 23, 2024
407
0
Share:

[ad_1]

LG Electronics, a global leader in technology and innovation, joined the Federal Ministry of Water Resources and Sanitation in the global celebration of the United Nations World Water Day by donating a solar-powered borehole to the Gudu Community in Abuja.

The theme of this year is ‘Water for Peace’, emphasizing the vital significance of water in ensuring the stability and prosperity of our world.

In situations where water is limited or contaminated, or where access is unequal or nonexistent, tensions can escalate between communities and nations.

PIX 7
L-r: the honorable minister, federal ministry of water resources and sanitation, prof. Joseph terlumun utsev, , country director of united nations educational scientific and cultural organization (unesco), dr. Abdourahmane diallo and managing director, lg electronics west africa, mr. Hyoung sub ji at the commissioning of donated solar-powered borehole by lg electronics to durumi 3 community in abuja to commemorate the united nations world water day 2024 today in abuja.

It is crucial to proactively tackle water-related issues to prevent conflicts and encourage collaboration for sustainable water management.

A series of events took place to celebrate this special day from the Peace walk around FCT to the special press conference with all the relevant partners, international NGOs, Federal Ministries representatives, and private corporations.

PIX 1A
L-r: (bottom row) the director general, nigeria hydrological services agency (nihsa), engr. Clement nze, the honorable minister, federal ministry of water resources and sanitation, prof. Joseph terlumun utsev, country director of united nations educational scientific and cultural organization (unesco), dr. Abdourahmane diallo, chief of wash, unicef nigeria, dr. Jane bevan and managing director, lg electronics west africa, mr. Hyoung sub ji at the commissioning of donated solar-powered borehole by lg electronics to durumi 3 community in abuja to commemorate the united nations world water day 2024 today in abuja.

Speaking at the commissioning of the solar-powered borehole, the Minister, Prof. Joseph Terlumun Utsev said; “We are extremely happy to celebrate yet another World Water Day with everybody and in particular with the donation of this borehole which is most significant of the celebration. The Gudu Community is grateful for this”.

“All year round we sensitize and celebrate the day to bring attention to one of the leading environmental issues, the scarcity of water.” Water is life, and we cannot even imagine our life without water. Water means a lot to us more than just quenching our thirst, but it plays the role of a vital component of human development; This day provides us an opportunity to think about this issue and how we can make a difference”

The Minister additionally said “Around 2 billion people around the world do not have access to clean and safe drinking water, and approximately 3.6 billion people – 46% of the world’s population – lack adequate sanitation services, according to a new United Nations World Water Development Report released. This is a major contributor to the spread of waterborne diseases such as cholera, typhoid, and diarrhea”

Prof. Utsev added, “In Nigeria, approximately 60 million people lack access to safe water sources, leading to numerous health challenges and impeding socio-economic development.”

Hence we need to keep appealing to corporate organizations such as what LG Electronics has done today to provide good drinking water for vulnerable communities like Gudu and all across the country so we can gradually reduce the numbers”

PICC
L-r: the honorable minister, federal ministry of water resources and sanitation, prof. Joseph terlumun utsev, country director of united nations educational scientific and cultural organisation (unesco), dr. Abdourahmane diallo and managing director, lg electronics west africa, mr. Hyoung sub ji at the commissioning of donated solar-powered borehole by lg electronics to durumi 3 community in abuja to commemorate the united nations world water day 2024 today in abuja.

Also at the event, the Managing Director, LG Electronics, Mr. Hyoung Sub Ji thanked the Ministry for the opportunity to collaborate with them to contribute to the community. He said the relevance of LG’s slogan cannot be over-emphasized which is “Life’s Good” With good drinking water people can live and have a good life. This is what has prompted us to do this” he said

Mr. Ji advised “This year, we at LG are proud to align with the theme of Water for Peace. We urge other corporate organizations to collaborate with relevant institutions in combating the scarcity of clean water, which tragically leads to the premature deaths of vulnerable children and adults nationwide.

Together, through partnership and collective action, we can make a significant impact on ensuring access to safe and clean water for all. Let us work hand in hand towards a future where every individual has the basic human right to clean water, promoting health, peace, and prosperity in our communities.”

PIX2222
L-r: the district head, garki chief tanko zekeri, abuja branch manager, fouani nigeria limited, mr. Mostapha khrais, director, water resources projects and planning, federal ministry of water resources and sanitation, engr. Ade adenopo, managing director, lg electronics west africa, mr. Hyoung sub ji, and the durumi 3 chief, chief iya bawa at the commissioning of donated solar-powered borehole by lg electronics to durumi 3 community in abuja to commemorate the united nations world water day 2024 today in abuja.

Giving a thank you speech, the leader of the community, Alhaji Jubril Musa said, “We are very happy for this water as it solves more than half of our challenges. We will ensure we safeguard the borehole to last longer for us in the community. We thank LG Electronics and the Ministry for the gesture”

Present at the celebration are WaterAid, United Nations International Children (UNICEF), Education Fund (UNICEF), UNESCO, Action Against Hunger, Gillmor Engineering Nigeria Limited, FORDMAX Nig. Limited, CGC Nigeria Limited, Food and Agricultural Organization, (FAO), Borehole Drillers Association of Nigeria (BODAN), Nigeria Hydrological Services Agency (NIHSA), and other relevant ministry representatives.

PIX 5

LG Electronics continues to demonstrate its commitment to environmental sustainability and social responsibility through initiatives like this.

Clean and easily accessible water is indispensable for economic growth, public health, and environmental integrity. By giving priority to water as a means for peace, we can strive towards a more balanced and harmonious global community.


Featured Image: Abuja Branch Manager, Fouani Nigeria Limited, Mr. Mostapha Khrais, The Durumi 3 Chief, Chief Iya Bawa, Managing Director, LG Electronics West Africa, Mr. Hyoung Sub Ji and Director, Water Resources Projects and Planning, Federal Ministry of Water Resources and Sanitation, Engr. Ade Adenopo at the commissioning of donated Solar-powered Borehole by LG Electronics to Durumi 3 Community in Abuja to commemorate the United Nations World Water Day 2024 today in Abuja.


Don’t miss important articles during the week. Subscribe to techbuild.africa weekly digest for updates



[ad_2]

Source link

Tagscommunitydayeducationeventfacebookfoodgoodgratefulhappyhealthlifelivenewpeacepeoplethetodaywaterworkworld
Previous Article

Reformation Swimwear Is Here — and It’s ...

Next Article

What channel is Clemson vs. Baylor (3/24): ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Rihanna’s provocative XXL shoes

    August 19, 2022
    By admin1
  • Home&Living

    Capture Your Memories This Black Friday with Inkifi’s Exclusive 40% Off Sale

    November 30, 2024
    By admin1
  • Travel & Lifestyle

    Podium | Education Is Going Wrong | Opinion

    September 21, 2022
    By admin1
  • Fashion

    Louis Vuitton Colormania Luggage Is Here + More Fashion News

    November 10, 2023
    By admin1
  • All

    Guide to Instagram Analytics: Tips and Tools

    September 1, 2022
    By admin1
  • Travel & Lifestyle

    Alison Yoshimoto Towerley Joins State Board of Education

    September 13, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    ‘Moneyball’ for gun crews: Surprising data have Army division reshaping its gunnery training

  • Science & Tech

    Career in Science | Philstar.com

  • Science & Tech

    Science 2 Go: Hurricane names

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Utah’s Nomi Health Expands in Hawaii, Donates to Blue State Democrats

    By admin1
    September 8, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy