Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Fashion
Home›Fashion›Guerlain Neroli Fragrance: Neroli Plein Sud is Here + More Beauty News

Guerlain Neroli Fragrance: Neroli Plein Sud is Here + More Beauty News

By admin1
February 2, 2024
466
0
Share:

[ad_1]

Photography Courtesy of Guerlain

Plus, M.A.C Cosmetics reformulates their iconic matte lipsticks.

By
Lauren Knowles

Date February 2, 2024

Guerlain unveils a new fragrance

guerlain neroli fragrance

“Picture kilometers of orange tree fields,” says perfumer Delphine Jelk over a video call. “The sky is blue, the sun is shining, and there’s a freshness in the air.” Jelk is describing the inspiration behind her latest creation, Guerlain’s Neroli Plein Sud. “One second, let me get something.” She reemerges on-screen with a travel diary from her time in Morocco. The notebook is filled with dried plants, sketches, and fabric swatches that inspired the luxe new fragrance. “I went to fashion design school before getting into perfumery, so I design fragrances exactly like I’d design clothes, starting with mood boards filled with colors, words, and pictures.

Néroli Plein Sud is born out of a collaboration with Antone de Saint Exupéry Youth Foundation, in honour of the beloved author of The Little Prince and Southern Mail (the latter which directly inspired the fragrance). To bring the latest addition to Guerlain’s L’Art & La Matière collection to life, Jelk combined neroli—an essential oil produced from the blossom of an orange tree–with turmeric, ginger, and cinnamon. At once crisp, spicy, and warm, she describes the scent as a “fresh breeze blowing over the hot sand of the Sahara [desert].”

Shop Now

Sulwhasoo’s S Line skincare collection has arrived


Fusing ancient knowledge with modern opulence, Sulwhasoo’s S Line is here to shake up the skincare space. Sought after for its youth-enhancing capabilities, the star Gingseng Berry SR ingredient (comprised of ginsenomics, a bioflavonoid and ginseng berry) is featured throughout the range.

Housed in a traditional Korean moon jar that doubles as a decorative statement piece, our favourite launch from the line is The Ultimate S Cream–which strengthens the skin’s moisture barrier and minimizes the appearance of fine lines and wrinkles.

Shop Now

M.A.C Cosmetics’ iconic matte lipsticks just got a makeover


This week, M.A.C Cosmetics upped the ante on its iconic OG matte lipsticks and revealed a reformulated version of their already beloved mattes, called the MACximal Silky Matte Lipsticks.

Adhering to a “maxed out to give lips more” mantra, these matte-meets-silk lipsticks boast more colour, comfort, and longevity than ever before. With over 30 shades—including cult classics like “Ruby Woo” and “Velvet Teddy—to play with, M.A.C is inspiring us to push our creativity to the max when it comes to makeup.

Shop Now

Olehenriksen adds three new shades to its Pout Preserve collection


Got a sweet tooth? Olehenriksen’s latest launch lets you wear your favourite dessert flavour on your lips. The Scandinavian skincare brand has just expanded its Pout Preserve Peptide Lip Treatment lineup to include shades Strawberry Sorbet, Cocoa Crème and limited-edition Blood Orange Spritz.

Featuring the same cloudberry seed oil, lip peptides, kokum butter and açai ingredients as the original Citrus Sunshine shade, this treatment will keep your pout looking smooth and juicy.

Shop Now

Tatcha drops a pore-purifying cleanser


If you’re already a fan of Tatcha cleansers like the Rice Wash and Camellia Cleansing Oil, allow us to introduce your new favourite: The Matcha Cleanse. This matcha-infused skincare staple leaves skin feeling squeaky clean but not stripped, reduces oil production, and primes the face for makeup application. The hero ingredient, Japanese Kyo-Matcha, is sourced straight from Uji, Japan–the best-known region in the country for matcha production. Talk about top of the line.

Shop Now

YSL Beauty launches a waterproof version of Lash Clash


YSL Beauty’s viral Lash Clash Volumizing Mascara just got an upgrade—and if you’re gearing up for a Spring break getaway anytime soon, you’re going to want to pack it in your toiletry bag. The just-dropped Lash Clash Extreme Volume Waterproof Mascara is water-, heat-, humidity-, and smudge-proof. Plus, it thickens and boosts your lashes to extreme volumes (by 400 perfect to be precise) for up to 48 hours. Not a want, but a need.

Shop Now

Bioré introduces an SPF-packed moisturizer


If you’ve used winter weather as an excuse to skip out on wearing sunscreen lately, consider this your reminder to wear SPF all year round. Fortunately for us, Bioré’s newly launched UV Aqua Rich Weightless Moisturizer SPF 50 UVA & UVB  will keep our skin protected from both the dryness of the winter and harsh UV rays that reflect off of surfaces like ice and snow when it’s still cold out.

Taking inspiration from Bioré Japan’s water-based sun protection products, this hyaluronic-acid-rich moisturizer instantly absorbs into thirsty skin without leaving a dreaded white cast behind. No matter the season, we’ll be reaching for this one.

Shop Now

This article contains affiliate links, so we may earn a small commission when you make a purchase through links on our site at no additional cost to you.

More Beauty & Grooming

Beauty & Grooming

By
Lauren Knowles

Date January 26, 2024

Beauty & Grooming

By
Lauren Knowles

Date January 19, 2024

Beauty & Grooming

By
Lauren Knowles

Date January 12, 2024

[ad_2]

Source link

Tagsartbeautybluedesignfashioninspirationjapanlifemakeupmemoodnewphotographyskyspringsweettravelvideoviralwinter
Previous Article

How to watch Butler vs. Creighton (2/2/24) ...

Next Article

Colour! Layering! Smiles! Copenhagen Fashion Week Street ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Athlete walking the runway and making a statement during New York Fashion Week

    September 16, 2022
    By admin1
  • Health & Beauty

    Healthy Skin, Happy You: Discover Acne Treatments at Health Express

    November 1, 2023
    By admin1
  • Health & Beauty

    Health groups urge federal government to delay information blockade deadline by one year

    September 27, 2022
    By admin1
  • Travel & Lifestyle

    Texas School Board Delays Social Studies Updates

    September 2, 2022
    By admin1
  • All

    Public Media Solutions is making inroads into healthcare digital marketing to promote domestic healthcare ventures.

    September 2, 2022
    By admin1
  • Health & Beauty

    Steps to ensure plant health before bringing plants indoors – The Journal

    September 19, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Overnight camping trips for Howard Middle School students will be replaced with science-based day trips – Baltimore Sun

  • Science & Tech

    The Department of Food Science and Technology creates hokey-inspired ice cream.news

  • Science & Tech

    US Army scrambles to catch up to rising drone threat

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (52)
  • Gift Guides (23)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Church unites behind climate science – Chicago Tribune

    By admin1
    September 17, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy