Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Enrichissez votre expérience de lecture grâce à ces grands magazines français

      May 20, 2026
      0
    • Beyond the Clouds: Why This is NYC’s Most Immersive Experience

      May 14, 2026
      0
    • Entdecken Sie die besten Fantasy-Hörbücher für Kinder – voller Staunen und Hoffnung

      May 14, 2026
      0
    • Solve, Move, Win: The Nostalgic Thrill of the Classic Board

      May 14, 2026
      0
    • Beyond the Skyline: Discovering Boston’s Soul from 750 Feet

      May 14, 2026
      0
    • Découvrez le pouvoir du son à travers ces cinq récits à ne ...

      May 14, 2026
      0
    • Scopri i piani sanitari Premium per famiglie per la massima tranquillità a ...

      May 14, 2026
      0
    • Affordable Travel Protection Quotes for Your Next Global Vacation

      May 14, 2026
      0
    • Entdecken Sie preisgekrönte Kunsthotels und Boutique-Unterkünfte in Norwegen

      May 14, 2026
      0
  • Fashion
    • Rinnova il tuo guardaroba quotidiano con questi splendidi abiti midi di Pull&Bear

      May 14, 2026
      0
    • Capo essenziale dalla vestibilità squadrata e di qualità eccellente per una moda ...

      May 14, 2026
      0
    • Scopri la nuova collezione stagionale di top in cotone firmati

      May 14, 2026
      0
    • Premium Oversized Streetwear Shirts Featuring Bold High Definition Prints

      May 14, 2026
      0
    • Απαραίτητες μοντέρνες τσάντες ώμου για μια τέλεια κομψή καλοκαιρινή εμφάνιση

      May 14, 2026
      0
    • CREPSLOCKER: Your Ultimate Destination for Exclusive Sneakers and Streetwear

      May 1, 2026
      0
    • La guida dell'uomo moderno per padroneggiare il look casual perfetto

      April 28, 2026
      0
    • I cinque look in denim indispensabili per ogni guardaroba in questa stagione

      April 24, 2026
      0
    • Best Lightweight Football Shirts from Spain’s Most Passionate Clubs

      April 23, 2026
      0
  • Health & Beauty
    • Capsule di glicinato di magnesio puro per alleviare lo stress e garantire ...

      May 14, 2026
      0
    • Modern Hygiene Made Simple with Wype

      May 12, 2026
      0
    • GETKONG: Naadloze digitale gezondheidszorg binnen handbereik

      May 6, 2026
      0
    • GETKONG: Directe gezondheidszorg, overal en altijd

      May 6, 2026
      0
    • GETKONG: Geef je levensstijl een nieuwe impuls met mode en innovatie

      May 6, 2026
      0
    • GETKONG: Jouw weg naar welzijn, prestaties en een gezonder leven

      May 6, 2026
      0
    • Wype: Smarter Hygiene Solutions for a Cleaner and Easier Lifestyle

      April 23, 2026
      0
    • PetenKoiratarvike: Premium-Lemmikkiruokaa ja Hoitoa Jokaiselle Karvaiselle Ystävälle

      October 9, 2025
      0
    • Transform Your Skin with Dermstore’s Premium Vitamin C Serums

      September 18, 2025
      0
  • Science & Tech
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Enrichissez votre expérience de lecture grâce à ces grands magazines français

  • Scopri mobili belli e resistenti per ogni spazio esterno

  • Znajdź idealne opony do swojego samochodu w iParts

  • Everything You Need to Know About Specialized Travel Insurance Plans

  • Transforma tu cocina casera con estos hornos profesionales Balay

  • Ottimizza i tuoi costi energetici con le nuove soluzioni energetiche di E.ON

  • Najlepsze naturalne przekąski poprawiające codzienne samopoczucie Twojego psa

  • Inside the World of Espionage: The SPYSCAPE Experience

Fashion
Home›Fashion›Guerlain Neroli Fragrance: Neroli Plein Sud is Here + More Beauty News

Guerlain Neroli Fragrance: Neroli Plein Sud is Here + More Beauty News

By admin1
February 2, 2024
429
0
Share:

[ad_1]

Photography Courtesy of Guerlain

Plus, M.A.C Cosmetics reformulates their iconic matte lipsticks.

By
Lauren Knowles

Date February 2, 2024

Guerlain unveils a new fragrance

guerlain neroli fragrance

“Picture kilometers of orange tree fields,” says perfumer Delphine Jelk over a video call. “The sky is blue, the sun is shining, and there’s a freshness in the air.” Jelk is describing the inspiration behind her latest creation, Guerlain’s Neroli Plein Sud. “One second, let me get something.” She reemerges on-screen with a travel diary from her time in Morocco. The notebook is filled with dried plants, sketches, and fabric swatches that inspired the luxe new fragrance. “I went to fashion design school before getting into perfumery, so I design fragrances exactly like I’d design clothes, starting with mood boards filled with colors, words, and pictures.

Néroli Plein Sud is born out of a collaboration with Antone de Saint Exupéry Youth Foundation, in honour of the beloved author of The Little Prince and Southern Mail (the latter which directly inspired the fragrance). To bring the latest addition to Guerlain’s L’Art & La Matière collection to life, Jelk combined neroli—an essential oil produced from the blossom of an orange tree–with turmeric, ginger, and cinnamon. At once crisp, spicy, and warm, she describes the scent as a “fresh breeze blowing over the hot sand of the Sahara [desert].”

Shop Now

Sulwhasoo’s S Line skincare collection has arrived


Fusing ancient knowledge with modern opulence, Sulwhasoo’s S Line is here to shake up the skincare space. Sought after for its youth-enhancing capabilities, the star Gingseng Berry SR ingredient (comprised of ginsenomics, a bioflavonoid and ginseng berry) is featured throughout the range.

Housed in a traditional Korean moon jar that doubles as a decorative statement piece, our favourite launch from the line is The Ultimate S Cream–which strengthens the skin’s moisture barrier and minimizes the appearance of fine lines and wrinkles.

Shop Now

M.A.C Cosmetics’ iconic matte lipsticks just got a makeover


This week, M.A.C Cosmetics upped the ante on its iconic OG matte lipsticks and revealed a reformulated version of their already beloved mattes, called the MACximal Silky Matte Lipsticks.

Adhering to a “maxed out to give lips more” mantra, these matte-meets-silk lipsticks boast more colour, comfort, and longevity than ever before. With over 30 shades—including cult classics like “Ruby Woo” and “Velvet Teddy—to play with, M.A.C is inspiring us to push our creativity to the max when it comes to makeup.

Shop Now

Olehenriksen adds three new shades to its Pout Preserve collection


Got a sweet tooth? Olehenriksen’s latest launch lets you wear your favourite dessert flavour on your lips. The Scandinavian skincare brand has just expanded its Pout Preserve Peptide Lip Treatment lineup to include shades Strawberry Sorbet, Cocoa Crème and limited-edition Blood Orange Spritz.

Featuring the same cloudberry seed oil, lip peptides, kokum butter and açai ingredients as the original Citrus Sunshine shade, this treatment will keep your pout looking smooth and juicy.

Shop Now

Tatcha drops a pore-purifying cleanser


If you’re already a fan of Tatcha cleansers like the Rice Wash and Camellia Cleansing Oil, allow us to introduce your new favourite: The Matcha Cleanse. This matcha-infused skincare staple leaves skin feeling squeaky clean but not stripped, reduces oil production, and primes the face for makeup application. The hero ingredient, Japanese Kyo-Matcha, is sourced straight from Uji, Japan–the best-known region in the country for matcha production. Talk about top of the line.

Shop Now

YSL Beauty launches a waterproof version of Lash Clash


YSL Beauty’s viral Lash Clash Volumizing Mascara just got an upgrade—and if you’re gearing up for a Spring break getaway anytime soon, you’re going to want to pack it in your toiletry bag. The just-dropped Lash Clash Extreme Volume Waterproof Mascara is water-, heat-, humidity-, and smudge-proof. Plus, it thickens and boosts your lashes to extreme volumes (by 400 perfect to be precise) for up to 48 hours. Not a want, but a need.

Shop Now

Bioré introduces an SPF-packed moisturizer


If you’ve used winter weather as an excuse to skip out on wearing sunscreen lately, consider this your reminder to wear SPF all year round. Fortunately for us, Bioré’s newly launched UV Aqua Rich Weightless Moisturizer SPF 50 UVA & UVB  will keep our skin protected from both the dryness of the winter and harsh UV rays that reflect off of surfaces like ice and snow when it’s still cold out.

Taking inspiration from Bioré Japan’s water-based sun protection products, this hyaluronic-acid-rich moisturizer instantly absorbs into thirsty skin without leaving a dreaded white cast behind. No matter the season, we’ll be reaching for this one.

Shop Now

This article contains affiliate links, so we may earn a small commission when you make a purchase through links on our site at no additional cost to you.

More Beauty & Grooming

Beauty & Grooming

By
Lauren Knowles

Date January 26, 2024

Beauty & Grooming

By
Lauren Knowles

Date January 19, 2024

Beauty & Grooming

By
Lauren Knowles

Date January 12, 2024

[ad_2]

Source link

Tagsartbeautybluedesignfashioninspirationjapanlifemakeupmemoodnewphotographyskyspringsweettravelvideoviralwinter
Previous Article

How to watch Butler vs. Creighton (2/2/24) ...

Next Article

Colour! Layering! Smiles! Copenhagen Fashion Week Street ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    Fly Fishing International Honors Pineville Anglers for Commitment to Education

    October 22, 2022
    By admin1
  • Health & Beauty

    WHO delivers ambulance to Ukraine amid continuing attacks on healthcare

    September 2, 2022
    By admin1
  • Fashion

    Celebrities take advantage of vintage trends to sell on their favorite sites | Vintage Fashion

    August 28, 2022
    By admin1
  • Fashion

    Protect Your Hands with Heat Holders Men’s Thermal Gloves This Winter

    November 22, 2024
    By admin1
  • Travel & Lifestyle

    What Educators Need to Know about Generation Alpha

    February 2, 2024
    By admin1
  • All

    Thatware’s Tuhin Banik opens up his journey and what makes the SEO industry so dynamic

    August 25, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Best snow shovels for seniors in 2022

  • Science & Tech

    EPA Scientific Advisory Board Approves PFAS Drinking Water Standards

  • Science & Tech

    This camera can snap atoms better than a smartphone

Search

Categories

  • All (1,241)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,733)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (17)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,602)
  • Health & Beauty (22)
  • Home&Living (227)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,344)
  • Science & Tech (1)
  • Sports (30)
  • Technology (172)
  • Travel & Lifestyle (17)
  • Travel & Lifestyle (1,691)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Enrichissez votre expérience de lecture grâce à ces grands magazines français

    By techsmillion
    May 20, 2026
  • Scopri mobili belli e resistenti per ogni spazio esterno

    By techsmillion
    May 20, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • TikTok unveils new programming and creative effects for Fashion Month

    By admin1
    September 9, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy