Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys ...

      August 12, 2026
      0
    • Descubre Nueva York junto a otros en las visitas en grupo al ...

      August 11, 2026
      0
    • Au-dessus des lumières de la ville : des expériences inoubliables à l'One ...

      August 8, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

  • Erfrischen Sie sich, tanken Sie neue Energie und meistern Sie Ihren Tag mit dem Faxe Kondi Energy Booster

  • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys with Ferryhopper

Buying GuidesBuying GuidesFashionGift GuidesGift Guides
Home›Buying Guides›Gigi Hadid is shipping fashion to new heights as she sports mini dress made from DHL parcel tape for Vetements catwalk during Paris Fashion Week

Gigi Hadid is shipping fashion to new heights as she sports mini dress made from DHL parcel tape for Vetements catwalk during Paris Fashion Week

By admin1
September 27, 2024
470
0
Share:

[ad_1]

Gigi Hadid proved she is the whole package, as she shipped fashion to new heights in a mini dress made from DHL parcel tape for Vetements catwalk during Paris Fashion Week.

The model, 29, put on a very leggy display as she walked the catwalk in a short figure-hugging dress, which gave the illusion that she was wrapped in yellow and red packaging tape.

Adding inches to her statuesque physique as, she slipped into a pair of matching stilettos.

Closing the show alongside Travis Scott and Guram Gvasalia, she looked incredible with her ashy blonde tresses styled into a messy bob.

For the dramatic catwalk, Gigi showcased her natural looks with a simple nude makeup look.

Gigi Hadid, 29, proved she really is the whole package as she shipped fashion to new heights in a mini dress made from DHL parcel tape for the Vetements catwalk during Paris Fashion Week

Gigi Hadid, 29, proved she really is the whole package as she shipped fashion to new heights in a mini dress made from DHL parcel tape for the Vetements catwalk during Paris Fashion Week

The model put on a very leggy display as she walked the catwalk in a short figure-hugging dress, which gave the illusion that she was wrapped in yellow and red packaging tape

The model put on a very leggy display as she walked the catwalk in a short figure-hugging dress, which gave the illusion that she was wrapped in yellow and red packaging tape

Paris Fashion Week runs from September 23 to October 1, with a string of major designers choosing the City of Light to showcase their next collections.

L’Oreal kicked things off on Monday with a star-studded runway featuring the likes of Kendall Jenner, Heidi Klum, Eva Longoria and Cara Delevingne.

Tuesday saw Dior welcomed Anya Taylor-Joy and Rosamund Pike to the FROW before Saint Laurent was the highlight of the evening calendar.

The third day offers up Courrèges and Mugler presentations while Thursday will see the spotlight on Hermès and Giambattista Valli.

On Friday, Victoria Beckham will be supported by her A-list friends as she unveils her next ready-to-wear looks, with Rick Owens and Balenciaga also showcasing collections that day.

Valentino and Stella McCartney will also be hot tickets before French fashion house Louis Vuitton closes the week with its glitzy show.

Last Thursday, Gigi threw a baby Yoda-themed fourth birthday party for her daughter Khai.

Fans went nuts over the images shared to social media and they revealed the child’s last name for the first time. 

Adding inches to her statuesque physique as, she slipped into a pair of matching stilettos

Adding inches to her statuesque physique as, she slipped into a pair of matching stilettos

Closing the show alongside Travis Scott and Guram Gvasalia, she looked incredible with her ashy blonde tresses styled into a messy bob

For the dramatic catwalk, Gigi showcased her natural looks with a simple nude makeup look

Closing the show alongside Travis Scott and Guram Gvasalia, she looked incredible with her ashy blonde tresses styled into a messy bob

A photo of the Descendants-themed scroll read: ‘Khai Malik,’ with an invite from King Ben and his ‘councilors’ for her to attend Auradon Prep, the school featured in the Disney TV films. 

Fans were excited that the model – who split from the Zayn Malik, 31, in 2021 – finally shared Khai’s surname after previously evading the question.

‘THE 11TH PIC WHEN IT’S WRITTEN KHAI MALIK,’ one fan exclaimed.

It’s unclear if Gigi’s current boyfriend, 49-year-old actor Bradley Cooper, or Zayn were at the party as neither were featured in the snaps.

Both Gigi and Zayn shared touching tributes to their daughter for her special day. 

The model posted a number of snaps from the colorful party, accompanied by a gushing caption about her ‘adventurous’ and ‘loving’ daughter.

‘Our girl is 4 today and we celebrated all week!!! She loves animals (fantastical ones too), music, baby yoda, all things nature & bugs, Descendants, anything squishy or miniature, and if possible – will be in the water from dawn til dusk,’ she said.

‘She is curious, adventurous, loving, and oh so witty… Khai – it is my life’s greatest joy and pride to be your mama!!!!’

Gigi’s post showed her and Khai looking over at the pink and green birthday cake featuring Grogu — the adorable character from the Disney+ series The Mandalorian, who resembles the iconic Star Wars character Yoda. 

‘May the FOURce be with you,’ the writing on the cake read. 

Zayn shared his own birthday message to his daughter to Instagram.

He shared a snap of him holding Khai at the beach, and wrote, ‘Happy birthday to the most important person in my life.

‘I love you more than words allow me to express, beyond proud to call you my daughter… grateful for every second I get to spend next to you, as you become the incredible person I know you already are. 

‘Four years ago today my life changed forever and I wouldn’t be the man I am today without you.’

Paris Fashion Week runs from September 23 to October 1, with a string of major designers choosing the City of Light to showcase their next collections

Paris Fashion Week runs from September 23 to October 1, with a string of major designers choosing the City of Light to showcase their next collections

Gigi and Zayn dated for approximately five years. They welcomed their daughter in September 2020.

Reported tension between Zayn and and Gigi’s mother eventually led to their separation in October 2021.

Zayn was charged with four counts of harassment after he pleaded no contest to the charges after allegedly pushing Yolanda into a dresser and calling her a ‘f*****g Dutch sl*t’ in September 2021. 

She has since moved on with Bradley, who shares a seven-year-old daughter with model Irina Shayk, 38. The pair were first linked in October 2023. 

[ad_2]

Source link

Tagsbabybeachfashionfriendsgirlhappyinstagramlifelikeslooklovemakeupmemodelmusicnaturenewpartyphotopink
Previous Article

Two States Are Responsible for Most of ...

Next Article

YorkTest: The Key to Understanding Your Body’s ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    Northern Kentucky University is the first US to accredit its data science program

    September 15, 2022
    By admin1
  • Export TestSports

    Verbessern Sie Ihr Spiel mit dem Tennis-Point-Trainingsanzug

    September 15, 2024
    By admin1
  • All

    5 Digital Marketing Elements to Consider

    August 23, 2022
    By admin1
  • Home&Living

    FUNNYFUZZY Sofa Covers: Comfort, Style, and Waterproof Durability

    November 29, 2024
    By admin1
  • Science & Tech

    Runway Growth Capital Joins Life Sciences Team with New Dallas Managing Director » Dallas Innovates

    August 20, 2022
    By admin1
  • All

    3 Ways Small Businesses Can Grow Their Digital Marketing Strategy

    May 19, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Everton announces new head of sports science

  • Science & Tech

    Cloud labs and remote research are not the future of science.medical research

  • Science & Tech

    Science Talk – World Cancer Research Day: How International Collaboration Can Help the Global Cancer Research Community

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,752)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

    By techsmillion
    August 19, 2026
  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

    By techsmillion
    August 18, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Vermont property tax rate set to rise despite ‘substantial’ education surplus

    By admin1
    December 3, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy