Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Entdecken Sie die Freude am nahtlosen Reisen: Die Kraft von Deutschlandticket entfalten

      July 10, 2025
      0
    • Wählen Sie die beste Fähre für Ihre nächste Reise: Starten Sie in ...

      July 10, 2025
      0
    • The QHotels Collection – Elegant Escapes, Golf Retreats, and Relaxed Luxury Stays ...

      July 9, 2025
      0
    • Erkunden Sie Europas atemberaubendste Städte bequem und entspannt bei Ihrem nächsten Städtetrip

      July 9, 2025
      0
    • Caesars Rewards – The Ultimate Destination for Gaming, Luxury, and World-Class Hospitality

      July 9, 2025
      0
    • Discover Xcaret: Where Nature, Culture, and Adventure Come to Life

      July 9, 2025
      0
    • One World Observatory: Rise Above, See Beyond, Feel New York Like Never ...

      July 9, 2025
      0
    • Unveiling the Post Office: Unlocking a World of Convenience and Services

      July 9, 2025
      0
    • Direkt vom Bildschirm – Memmo liefert unvergessliche Momente

      June 25, 2025
      0
  • Fashion
    • Empowerment Starts Underneath: The EBY Revolution in Comfort and Purpose

      July 9, 2025
      0
    • Shop Ethical Fashion and Vintage Finds to Support Global Causes While Elevating ...

      July 9, 2025
      0
    • Wear the Change – Explore Comfort and Purpose with EBY Intimates

      June 26, 2025
      0
    • Seamless Confidence – Redefining Everyday Comfort with EBY Intimates

      June 20, 2025
      0
    • Stylish Finds for Little Ones: Shop Pre-Loved Kids' Dresses with Purpose

      June 13, 2025
      0
    • Jeden Kilometer meistern: Laufbar Laufjacke für Herren – Unübertroffener Komfort, Stil und ...

      June 10, 2025
      0
    • Scopri profumi femminili di lusso per ogni stato d'animo e occasione

      June 6, 2025
      0
    • Shop Smart, Dress Sharp: Ethical Superstore Men’s Shirts for a Stylish and ...

      June 4, 2025
      0
    • Transform Your Wardrobe with the Unmatched Style of Dresses from WAT THE ...

      June 4, 2025
      0
  • Health & Beauty
    • Choose the Right Fragrance for You: Top Perfumes That Define Femininity and ...

      July 9, 2025
      0
    • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

      June 12, 2025
      0
    • Verwandeln Sie Ihr Haar mit MiiN Cosmetics: Die ultimative Revolution in der ...

      June 11, 2025
      0
    • Verbessern Sie Ihre Wellness-Routine mit Lucky Hemp CBD Ölen

      June 11, 2025
      0
    • L'ARISÉ Beauty: Entdecken Sie den Reiz von pudriger Eleganz und zeitloser Raffinesse ...

      June 9, 2025
      0
    • Scopri i prodotti delicati per la cura dei capelli e per ottenere ...

      June 8, 2025
      0
    • Trasforma la tua pelle con questi prodotti idratanti essenziali – Sconti speciali

      June 6, 2025
      0
    • Le migliori soluzioni per la cura della pelle: protezione solare e sollievo ...

      June 6, 2025
      0
    • Experience Enhanced Wellness with Zooki’s Cutting-Edge Liquid Supplements Designed for Maximum Effectiveness

      June 6, 2025
      0
  • Science & Tech
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Drive Smart, Travel Far – Discover Flexible, Eco-Friendly Car Hire with Europcar Worldwide

  • Europcar – Reliable Car Rentals With Flexible Plans and Hidden Fee Risks

  • Entdecken Sie die Freude am nahtlosen Reisen: Die Kraft von Deutschlandticket entfalten

  • Wählen Sie die beste Fähre für Ihre nächste Reise: Starten Sie in Ihr nächstes Abenteuer mit den unvergesslichen Fährreisen von DFDS

  • Stampa come un professionista: libera prestazioni intelligenti e senza interruzioni con le stampanti HP

  • Step-by-Step Strategy for Successful Real Estate Transactions in California’s Competitive Market

  • The QHotels Collection – Elegant Escapes, Golf Retreats, and Relaxed Luxury Stays Across Iconic UK Destinations

  • Erkunden Sie Europas atemberaubendste Städte bequem und entspannt bei Ihrem nächsten Städtetrip

Health & Beauty
Home›Health & Beauty›Families say Sacramento homeless need more mental health resources

Families say Sacramento homeless need more mental health resources

By admin1
September 26, 2022
264
0
Share:

[ad_1]

Tanisha’s family told KCRA 3 that Tanisha was seriously injured in a hit-and-run accident near the garden in August. Sacramento Freeway and Northgate Boulevard. Doctors called her injuries “devastating.” See the full KCRA 3 news at 11 p.m. “Tanisha’s sister, Jonisha Dunbar, said. Family members said Tanisha eventually died of her injuries on Sept. 16. They were devastated following her loss.” The devastation has now calmed down.Tanisha’s family believes her death could have been avoided, adding to their distress.They said they had three children. Tanisha’s mother, who was homeless at the time of the accident and had struggled with bipolar disorder and schizophrenia for more than a decade, said a loved one said her mental health system had cracked her. said he got help at one point but claimed there was little to no follow up. And I think they should be doing more. 3 spoke to Sacramento County officials and they said they were more than happy to help address the mental health of homeless people. But Monica Rocha Wyatt, who oversees the Behavioral Health Initiative for Nonresidents in Sacramento County, said there are limits. As the department’s health program manager, Rocha-Wyatt said he is encouraging people in need to seek resources, one way is through the new Homeless Encampment Response Team (HEART). HEART is able to meet people where they are and connect them to the best resources for them to connect unhoused people to the best resources for them.And the best thing about this team is They provide easy case management and make sure they get to their first intake appointment.” I’m here. Dr. Ryan Quist, director of behavioral health for Sacramento County, said the department is also increasing resources by transforming its adult outpatient system. Previously he had 3 walk-in sights and is now expanding. Several sites have already opened, including a site near American His River across from Discovery Park and a site in the Natomas area. Quist said more personnel are expected to come online soon.But Quist added that there are still challenges facing his department, one of which is the workforce crisis. Quist said more staff are needed to provide advanced care to non-inmates with mental health issues. We have increased our compensation package by 16% to entice qualified people to apply for these positions. Establish a Community Support, Recovery, Empowerment, or Care-Court System in California. The CARE Court Program makes it easier for families and first responders to coerce psychiatric Californians into psychiatric treatment through court-ordered care.My mother is ill and hits the streets with this condition. You can’t,” Claudine said. While there is support for the CARE Court, the program has received pushback from many human rights groups. , claims it can lead to mentally ill patients stuck inside state hospitals. List of current and upcoming mental health walk-in sites in Sacramento County.

Sacramento, California —

Lovers are trying to hold on to the memory of Tanisha Deal, a Sacramento woman who lost her life after a horrific tragedy.

Tanisha’s family told KCRA 3 that she was seriously injured in a hit-and-run accident near Sacramento’s Garden Highway and Northgate Boulevard in August. Doctors called her injuries “devastating.”

  • Read the full story on KCRA 3 News at 11pm

“There was no brain activity. Her legs, hips, back, liver and lungs were all damaged beyond repair,” said Jonisha Dunbar, Tanisha’s sister.

The family said Tanisha eventually passed away on September 16 from her injuries.

“It’s indescribable pain. I don’t know how to describe it. I’m barely coping,” Jonisha said.

family seeking change

To add to the distress, Tanisha’s family believes her death could have been avoided. According to them, Tanisha, a mother of her three children, was homeless at the time of the accident and had suffered from bipolar disorder and schizophrenia for more than a decade.

A loved one said the mental health system dropped Tanisha through the cracks.

“That’s part of why we got here. We knew that one day we’d have to answer a question or answer a phone call that would change our lives forever.” All she wanted was help,” said Jonisha.

Tanisha’s family said they got help at one point, but claimed there was little to no follow-up.

Claudine Smith, Tanisha’s mother, said, “The mental health system is dropping the ball. It’s causing pain and death, and I think they should do more.

Sacramento County Homeless Mental Health Services

KCRA 3 spoke to Sacramento County officials and said they are doing all they can when it comes to addressing the mental health of homeless people. Monica Rocha-Wyatt, who oversees the health initiative, said there are limits.

“It’s the client, or the person experiencing homelessness, and ultimately it’s their choice.

Still, Rocha-Wyatt said as health program manager for the Sacramento County Department of Health Services, she encourages those in need to seek out resources. One way is the new Homeless Encampment Response Team (HEART). According to Rocha-Wyatt, HEART meets unhoused people where they are in order to connect them to the resources that best suit them.

“We have the ability to rate them on our services and link them to the right level or service in the field. The best thing about this team is that they don’t stop there. to make sure they go on their first intake schedule,” Rocha-Wyatt said.

Providers take over the chain of care, Rocha-Wyatt said, but counties follow the entire process.

Dr. Ryan Quist, Director of Behavioral Health for Sacramento County, also said the department is increasing its resources by transforming its adult outpatient system. Previously he had 3 walk-in sights and is currently expanding.

“We are currently in the process of implementing a completely new treatment system, which has actually increased the number of sites to 10 ambulatory clinics,” says Quist.

Several sites are already open, including a site near American River across from Discovery Park and a site in the Natomas area. Quist says more are on the way soon.

But Quist added that there are still challenges facing his department. One of them is the workforce crisis.

“We need more people to do this important work. We have over 100 clinical positions open,” said Quist.

Quist said more staff are needed to provide advanced care to unhoused people with mental health issues. Quist has been active in hiring events and said he has implemented a 16% increase in compensation packages to entice talented people to apply for these positions.

Law of CARE Court Signed into Law

Some families, including Tanisha, are also in favor of new legislation establishing California’s Community Support, Recovery and Empowerment (CARE) court system. The CARE Court program makes it easier for families and first responders to enforce psychiatric treatment for mentally ill Californians through court-ordered care.

“They should allow court orders so that mothers and sisters and daughters can go there and say, ‘My mother is sick and she can’t be on the street in this condition,'” Kroe said. Ding said.

Although CARE Courts has some support, the program has faced opposition from many human rights groups. They argue that it goes against people’s freedom of choice and that mental patients could be confined to state hospitals.

Link to resource

For more information on Homeless Camps and Response Teams (HEART) by the Sacramento County Department of Health Services, click here.

For a list of current and upcoming mental health walk-in sites in Sacramento County, click here.

[ad_2]

Source link

Tagsbestcaliforniadayfamilyfollowforevergardenhappyhealthlifemynewnewsrunsistersistersstreettimewomanwork
Previous Article

AISD was selected as a 2022 Special ...

Next Article

MU Health Care works with Siteman Cancer ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Why celebrities invest in fashion brands – WWD

    September 17, 2022
    By admin1
  • Travel & Lifestyle

    MacroTutor: DSN Unveils AI-Powered On-Demand Education Platform to Prepare Students for Future Jobs

    August 29, 2022
    By admin1
  • All

    ACs, climate change, and the future of cooling tech

    August 10, 2022
    By admin1
  • All

    Jill Fescher on Creating Your Own Job Description at a Digital Marketing Agency

    August 22, 2022
    By admin1
  • Fashion

    ‘Tell me why Ferrari puts on a fashion show’: Fans go wild for meme-worthy looks Ferrari fashion show graced

    September 25, 2022
    By admin1
  • All

    How the Metaverse Will Change Digital Marketing

    September 13, 2022
    By admin1

You may interested

  • Science & Tech

    Hummingbird Biosciences Inaugurates Singapore Science Park Offices and Research Facility

  • Science & Tech

    Get these science books at a discount with last-minute back-to-school deals

  • Science & Tech

    The Kentucky Science Center announces the name of the newly installed World’s Fair Triceratops.news

Search

Categories

  • All (1,240)
  • Animal Food (19)
  • Books & Novels (21)
  • Buying Guides (22)
  • Buying Guides (32)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,710)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (16)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,591)
  • Health & Beauty (21)
  • Home&Living (218)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (10)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,346)
  • Science & Tech (1)
  • Sports (23)
  • Technology (157)
  • Travel & Lifestyle (1,651)
  • Travel & Lifestyle (14)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Drive Smart, Travel Far – Discover Flexible, Eco-Friendly Car Hire with Europcar Worldwide

    By admin1
    July 10, 2025
  • Europcar – Reliable Car Rentals With Flexible Plans and Hidden Fee Risks

    By admin1
    July 10, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Jones graduates from the U.S. Chamber of Commerce Foundation Education and Workforce Fellowship Program

    By admin1
    September 15, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy