Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›ColoradoSPH PhD Candidate Appointed APHA & Kaiser Community Health Scholars

ColoradoSPH PhD Candidate Appointed APHA & Kaiser Community Health Scholars

By admin1
September 12, 2022
395
0
Share:

[ad_1]

Shenazar (Shane) Esmund & Makara Carrington

Two Doctor of Public Health (DrPH) students from CU Anschutz’s Colorado School of Public Health have been selected as part of the 2022 American Public Health Association (APHA) and Kaiser Permanente (KP) Community Health Scholars Program. Makala Carrington and Shenazar (Shane) Esmundo are one of her 19 candidates selected for competitive scholarships awarded to graduates seeking DrPH or MPH degrees. Awards help cover tuition fees.

The scholarship program recognizes “a diverse group of underrepresented public health leaders committed to improving health in the most vulnerable communities and helping achieve health equity for all across the country.” It’s an initiative to create a group.” ColoradoSPH is one of eight institutions participating in the program.

Dani Britten, Ph.D., Associate Dean of Academic and Student Affairs, Colorado SPH, said the scholarship and fellowships awarded to two Colorado SPH MPH alumni said: ”

In separate interviews, Carrington and Esmund each described their path to public health and their future work as doctoral candidates.

Military Service and Public Health Efforts Make a Healthy Combination

Makala Carrington grew up with two influences that seemingly have little in common: military service and public health work. For her, they created the ideal fit.

Carrington grew up near Fort Bragg Army Base in North Carolina. This base is he one of the largest military installations in the United States. Her father retired there after he served 20 years in the United States Army. She remembers him waking up singing “Jody” and accompanying him to the base’s concession stand, seeing people in uniform, understandably.

“That’s the life I grew up with and wanted to continue,” Carrington said. “I wanted to be in that space.”

At the same time, Carrington added, her mother had served the community for more than 20 years at a public health agency. Her work of hers also piqued her interest. Though she stuck with her military service, Carrington found a bridge to public health while scrolling through the U.S. Air Force website: Looking for her job, she found herself I found a job that suits me. She’s a public health officer.

many paths to career

So she headed to the University of North Carolina at Charlotte (UNCC) to earn a Bachelor of Science in Public Health. She then went on to study at the University of North Carolina Chapel at the University of North Carolina. I am a PhD candidate in public health.

All the while, Carrington’s commitment to military service and public health never wavered. She is a U.S. Air Force officer and has extensive experience in programs that have addressed building community engagement, promoting health equity, workforce development and enhancing her leadership skills.

“All of my professional and personal experience exemplifies this holistic view of public health,” Carrington said.

She also found an early and permanent career path through the American Public Health Association (APHA) and the Centers for Disease Control and Prevention (CDC). As an undergraduate, Carrington participated in APHA student assemblies, served as a campus liaison to the organization, and has attended the annual conference since 2017. She is currently a Section Councilor for APHA’s Community Health Planning and Policy Development Section.

Along the way, Carrington completed two undergraduate internships through CDC’s Undergraduate Public Health Scholar (CUPS) program. First at Morehouse’s College of Public Health Sciences in Atlanta, then John’s in Baltimore at Hopkins University School of Nursing.

The road to injury prevention

The placement of Johns Hopkins proved pivotal in Carrington’s early career. I met a recognized Dr. Jackie Campbell. Carrington assisted Campbell in researching domestic violence in immigrant and refugee communities in the Baltimore area.

“This job was a turning point for me,” and Campbell became a “mentor for life,” Carrington said. ASPPH) reinforced her commitment to finding ways to protect against injury.

“After three years in injury prevention, I feel like I’ve found my niche,” Carrington said.

That work continued at Colorado SPH, where Carrington is a graduate research assistant at Marian (Emmy) Betts, MD, MPH, the leading national voice in firearms injury prevention. is Associate Director of the Center for Injury and Violence Prevention in SPH, Colorado. Carrington works with Betts and her team on a violence prevention project at Buckley Space Force Base in Aurora.

“Makara’s public health and military background made her a perfect fit,” Betts said.

Carrington also said he looks forward to helping educate the next generation of public health professionals and increasing the number of underrepresented individuals in the profession.

The APHA/KP scholarship provides financial support to help her achieve her goals, but Carrington concludes that the value goes beyond that.

“It motivates me to do this work,” she said. “It also helps you feel confident about who you are professionally, what you can do, what you’re going to do, without boundaries.”

A Public Health Career Deeply Rooted in the Filipino Community

A first-generation Filipino who grew up in the Los Angeles area, Shenazar (Shane) Esmund is quick to admit that he knew nothing about public health until he entered college. Many other everyday concerns occupied her.

Raised by his mother and grandparents, Esmund moved around, attending five elementary schools in Los Angeles before the family settled in the San Fernando Valley. After her high school, she enrolled at California State University, Los Angeles, where she planned to become a nurse. After taking several public health courses, she changed her mind.

“I was drawn into public health and wanted to learn more about it,” Esmund said. “I was drawn to the connection to real-world problems.”

The public health challenges she learned were connected on a personal level. Her idea that Filipinos and other immigrant communities face language, economic and cultural barriers, combined with her own experience, inspired her to do something.

“Growing up, I didn’t realize my family and I were going through the same health disparities that we were learning about in class,” Esmund said. “It was a moment of reflection for me.”

important mentorship

On his way to a bachelor’s degree in public health, Esmund also found a mentor. Her Melanie Sabado-Liwag, PhD, director of Cal State-LA’s Master of Public Health (MPH) program and also a first-generation Filipino college student, MPH considers Esmundo to further her education urged you to do so.

“She opened up the idea of ​​getting a master’s degree or getting an education that I didn’t really think was possible,” Esmund said. “It was nice to have a mentor to guide me through the process.”

Encouragement from Sabado-Liwag proved decisive and Esmundo completed MPH in Northridge, California. She is currently in the next phase of her training and is a candidate for Public Health Physician in Community and Behavioral Health at Colorado SPH – CU Anschutz.

Strong track record in community health and cancer prevention

Esmundo brings a wealth of practical experience to the program. For the past three years he has worked at Cedars-Sinai Medical Center in Los Angeles and most recently as a Clinical Research Coordinator at the Cancer Research Center for Health Equity. She moved to Denver, but she continues to work remotely and part-time.

Her interest and commitment to cancer prevention also has a personal tinge. Her father died of cancer while living in another country.

“Working at the cancer center was a full circle for me,” Esmund said. “Losing my father was a big driving force for me to do this work.”

Esmundo gained early experience at Cedars-Sinai as a research intern. She piloted a cancer awareness campaign in the Filipino community that included surveys measuring her knowledge, attitudes and beliefs about cancer screening. Over 1,000 surveys were collected as a result of this effort. They also found that Filipinos underutilized screening services and identified both motivations and barriers to cancer screening. This information helped design a prevention program.

Helping others navigate the healthcare system

Her subsequent community work included developing training for medical navigators to guide people in the Filipino community through the twists and turns that often disrupt the healthcare system.

“Working with the community and gaining buy-in is very difficult,” says Esmundo. “We need to make sure people are being heard and that they are actually listening.”

At Colorado SPH, Esmund is Patricia Valverde’s Graduate Research Assistant, PhD, MPH, Principal Investigator of the Patient Navigator Training Collaborative at the Colorado SPH Public Health Practice Center and a key advocate for the profession.

“I was thrilled to see Shane’s extensive experience in cancer prevention and management,” Valverde said. “Her research skills will enhance our program evaluation efforts. I can’t imagine a better fit for us.”

The APHA/KP scholarship eases the financial burden Esmund felt growing up. But she’s also excited about the opportunity to expand her knowledge of public health and find new ways to help people. I am interested.

“We’ve made great strides in technology, but people aren’t necessarily more advanced in using them,” she said. “How can we close that gap?”

Ultimately, Esmund aims to help people like her grow up build bridges for themselves.

“We may be researchers, but they are the ones who know our communities best,” she said. “We have to give them a platform that empowers them to make decisions.”

Written by Tyler Smith for the Colorado School of Public Health.





Categories:

Colorado School of Public Health| |


tag:

Colorado SPH Student and Alumni News


[ad_2]

Source link

Tagsarmybestcaliforniadesignfamilyfitgoalshealthhealthylifememynewniceperfectstrongtrainingviewworkworld
Previous Article

LocaliQ Unveils New Logo and ‘Seize Your ...

Next Article

Dealer Alchemist Ranked #761 on 2022 Inc. ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • All

    Top 10 Best Performance Marketing Agencies In India In 2023

    September 28, 2022
    By admin1
  • Science & Tech

    Defense Business Brief: Betting big on Australian AI; Q3 earnings; Lockheed’s tanker exit; and more…

    October 24, 2023
    By admin1
  • Health & Beauty

    Alexandria Museum exhibit commemorates 150-year-old women’s health care enterprise

    November 6, 2022
    By admin1
  • Fashion

    From Street to Chic: Elevate Your Wardrobe with Trendy Women’s Trainers and Pumps

    February 2, 2024
    By admin1
  • Health & Beauty

    Student loan forgiveness: When do student loan payments resume?

    October 22, 2023
    By admin1
  • Travel & Lifestyle

    Nights of Power – Muslim Aid’s Automated Donation Platform for Laylatul Qadr

    April 3, 2024
    By admin1

You may interested

  • Science & Tech

    College dropped out of science business major – The Observer

  • Science & Tech

    Biden’s FDA must listen to its own advice on vape products and ‘follow the science’ – InsideSources

  • Science & Tech

    MCT Oil Benefits and Side Effects – According to Science

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,345)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Des Moines-Based Platform Hummingbirds Pollinates Society’s Goodness

    By admin1
    September 19, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy