Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

All
Home›All›PHDCCI-Kashmir, in partnership with the Ministry of Commerce, conducts capacity building programs for Namuda artisans

PHDCCI-Kashmir, in partnership with the Ministry of Commerce, conducts capacity building programs for Namuda artisans

By admin1
September 15, 2022
449
0
Share:

[ad_1]

Srinagar September 15 (KNS): PHDCCI-Kashmir in collaboration with Department of Handicrafts and Directorate of Handweaving Kashmir, supported by Ministry of Commerce and Industry, Ministry of Commerce of India in a series of programs, 3rd Capacity Development for Artisans of Namda Manufacturers on 14th The program was conducted – September 15th at the conference hall in Numaish (Kashmir Hart) Srinagar. A major feature of the program was the interaction between Namda Artisans and Handicrafts & Handloom Kashmir Director Mr Mehmood Ahmad Shah (JKAS).

The completion of the registration process and manufacturing of Namdas prepared by the School of Designs and the commissioning of specific Bagialimardan machines at the Namda Manufacturers’ Common Facility Center was a decision made by the Director Handicrafts during the programme. It was also decided to hold a joint meeting with experts from SKUAST on sourcing raw materials for Namda and other technical interventions from his NID for design interventions that would help revive the NAMDA craft. Through these interventions, it is ensured that new models can be developed. New products to revitalize this craft to create livelihood opportunities for artisans on several Namda manufacturing processes including carding, making borders, making layers, spreading soap, final rolling and drying About developing , Mehmood Shah said: are a very important part of Kashmiri households and few homes are without these rugs.Namda craft are rugs made of wool by felting technique instead of the usual weaving process. Due to low quality and lack of skilled manpower and marketing skills, exports of this craft decreased by almost 100% between 1998 and 2008. The handicrafts sector contributes to the preservation and revival of crafts through these capacity building programs and other training programs. A rich heritage associated with Kashmir’s Namda craft.

The program involved 26 Namda artisans from different regions and craft clusters in the Srinagar district. Riyaz Ahmed Kawusa, Assistant Director of Promotion and Exhibition Department, was also present at Handicrafts and Handroom Kashmir. Qalab Hussain, resource officer at the Designer School of Design, emphasizes topics, the importance of design in crafts, creating sophisticated designs for export quality, developing new and innovative designs and improving quality. Did. Dr M Ashraf Parray Assistant Professor, Department of Business Administration, IUST University Explained the concept of marketing, the definition and scope of digital marketing, different types of digital marketing tools, how to analyze their features and benefits, and choosing the best digital marketing platform through analysis. We also provided craftsmen with guidance and insight on how to create their own social media platform to post product and skill details. He further taught them the design to create their own catalog and nuances of conversational commerce and trained them to identify digital marketing threats and challenges.

Dr. Mohd Sayyed Bhat from the Institute of Chemical Technology, Mumbai explained the importance of packaging to craftsmen and made them understand the importance of packaging especially for handicrafts in Namda.

Namda’s artisans were made to visit the design school by Shahena Bhat Designer School of Designs to observe Namdas new design patterns and various designs prepared and designed by the School of design were shared with the artisans. The craftsmen were told to visit the design school frequently for the latest designs and product quality improvement.

While commending the Handicrafts Department and PHDCCI for their role in organizing such a wonderful enlightenment workshop, he said that the craftsmen had learned and enriched a lot through the two-day programme, learning in packaging, design and marketing. He said he plans to adopt the technology. (KNS)

[ad_2]

Source link

TagsbestbuildingBusinesscraftdaydesigndesignerdetailsindiamarketingnewschoolthetraining
Previous Article

Health policy, medical research, clinical care & ...

Next Article

Patagonia founder sells company – proving fashion ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    What Science Says About How Leaders Build Trust: The 7 Best Strategies

    September 18, 2022
    By admin1
  • Home&Living

    Intelligentes Wohnen, brillante Beleuchtung: Entdecken Sie die frühen Black Friday-Angebote von Govee

    November 20, 2024
    By admin1
  • All

    hoola wins Most Trusted Digital Marketing Agency

    September 23, 2022
    By admin1
  • Health & Beauty

    Pandemic helps bring new awareness to mental health

    September 2, 2022
    By admin1
  • Travel & Lifestyle

    ‘Gen Z Teaches History’ Is a Viral TikTok Series That Mixes Learning and Humor

    October 24, 2023
    By admin1
  • Travel & Lifestyle

    Blooms in Harmony: Exploring the Elegance of Hand-Tied Bouquets at Bunches

    February 16, 2024
    By admin1

You may interested

  • Science & Tech

    Why do people get phobias?

  • Science & Tech

    Hands-on Science Showdown Sept. 14 with Free Interactive Field Trips | Events of Local Interest

  • Science & Tech

    Another voice: Teachers need to fully understand the science of reading.opinion

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Bringing Necessary Skills to Nigerian Youth

    By admin1
    September 8, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy