Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Science & Tech
Home›Science & Tech›Feminist science is not a contradiction

Feminist science is not a contradiction

By admin1
September 15, 2022
527
0
Share:

[ad_1]

Meearly days During the Covid-19 pandemic, a mystery spread in the news headlines. Men appeared to die from infections at twice her rate as women. To explain this startling disparity, researchers looked at inherent biological differences between the sexes, such as protective levels of sex hormones and distinct immune responses in males and females. Some even went so far as to test the feasibility of treating infected men with estrogen injections.

As a group of researchers affiliated with Harvard University noted earlier this year, this focus on biological sex differences has turned out to be woefully inadequate. By doing so, we can more fully explain the gender gap by social factors such as mask wearing and distancing behavior (less common in men) and testing rates (higher in pregnant women and women). was shown to be health care workers, most of whom were women).

Researchers have uncovered a long-standing trend in medicine to attribute differences in health outcomes to biological rather than social factors. In fact, for reasons unrelated to immunity and hormones, men had higher mortality long before the pandemic. It was important to consider how we interact with inequality.

The 2022 paper is just one example of how feminist intervention can turn bad science on its course and advance the field from epidemiology to evolutionary biology. It was written by members of the Gender Sci Lab, a multidisciplinary research institute that embraces feminist science. This research aims to identify and explore common assumptions about sex and gender that many people, including scientists, make unconsciously.

But most people who came across these findings probably didn’t know that feminism played a role in the research. In his three-year report in his 2022 book Vagina Obscura: An Anatomical Voyage, he explores how the majority of researchers view feminist science and how feminist scientists have to deal with the tools they have to offer. I encountered a deep chasm in between.

As a group of researchers affiliated with Harvard University pointed out earlier this year, this focus on biological sex differences has turned out to be woefully inadequate.

It’s not hard to see why. Among mainstream scientists, the term feminist has often been viewed with contempt, hostility, and an implicit belief that feminist ideals are incompatible with true science. The latter, objective authority.

In practice, feminist science provides powerful tools for examining the histories, contexts, and power structures that question scientific questions. Bringing marginalized perspectives to the table can generate new questions and methodologies that help scientists identify and correct hidden biases. Think of it like a stake fixed to a growing tree. This provides a foothold to help the tree return to its original trajectory when it leans too far to one side.

“Feminist science in the field doesn’t look any different than any other science,” says Heather Shattuck-Heidorn, an evolutionary biologist and co-founder of the GenderSci Lab. people). She says, “There are hypotheses that are supported and hypotheses that are not supported, and you run the analysis, test things, operationalize the variables.”

The difference lies upstream, who takes center stage and which questions are weighted. The more scientists understand this, the better science we can make for everyone.

get the newsletter

Send weekly

Unfortunately, this misconception is deep-seated. Just ask evolutionary biologist Patricia Gowerty, who was radicalized by the feminist movement of the 1960s and her 1970s and was one of the first researchers to earn the title of feminist scientist. In 2012, Gowaty conducted a series of careful replication experiments with Drosophila that challenged the long-held ‘Bateman principle’ of sexual selection.

Her findings help show that this principle that men tend to be more promiscuous than women because of the asymmetry between sperm and eggs is only a hypothesis and is flawed. However, outside of the Gender Studies Department, Gowati’s work is not widely taught. On the other hand, in hallowed halls like Oxford, Bateman’s principle is still canon.

Part of the reason, author Lucy Cook writes in her recent book, Bitch: On The Female of the Species, is that Gowati has effectively been branded as an ideologically driven feminist. increase. “The F-word has a polarizing effect that can undermine solid science,” writes Cook. Even the scientists I interviewed for the book used these tools. Feminists in their work.

But does it really matter? As long as science is perfect, who cares what we call it?

What we lose when feminism is minimized is an understanding of how science actually works.

I would argue that it is important. What we lose when feminism is minimized is an understanding of how science actually works. (and should be objective) perpetuates the outdated idea. When a scientist walks into a lab, they somehow get rid of the values, quirks, and preconceptions that plague us humans. In practice, objectivity, whether racial science is used to support eugenics policies or pro-life lawyers curating research to prove that life begins at conception has long served as a cover for political purposes.

Ironically, sticking to the model that science is objective makes science less objective, less susceptible to criticism, and easier to redirect for nefarious purposes. . Getting the scientific tree straight means first acknowledging that researchers never, in the words of the philosopher Thomas Nagel, “act on what they see out of nowhere.” Scientists, like feminists, have agendas and values, blind spots and biases, just like all of us. Each of us sees through our own limited lens.

By putting the lens back on scientists themselves, feminist scientists are able to see these hidden biases and rectify them. The co-authors pointed to a long history of science using biology to explain perceived gender and racial differences, a history steeped in Western imperialism and eugenics. This made the GenderSci Lab skeptical of purely biological explanations and began investigating other hypotheses.

This isn’t the first time feminist science has corrected wrong science. For decades, scientists have described sperm as the active agent that seeks out and penetrates passive eggs. Feminist anthropologist Emily Martin pointed to the sexist trope underlying this story, prompting researchers to discover an equally active element within women’s bodies…the preparation in the first place.

Similarly, sexual development in the womb has long been described as proceeding along one of two pathways in the segment of the so-called masculinity-encoding Y chromosome that signifies the development of the testis and penis. . Or, as one textbook from 2017 put it, its lack led to ovarian and clitoris development “by default.”In this view, the woman was like the factory settings for her iPhone. but the men had a version with bells and whistles.

Both ideas were based on the premise that the female body is more passive, simpler, and the default setting for the body. As these assumptions came to light, it became clear that female development had not been subjected to the same scrutiny as male development. , spurring the discovery of a genetic component that suppresses the male pathway and leads to ovarian development.

Scientists, like feminists, have agendas and values, blind spots and biases, just like all of us. Each of us sees through our own limited lens.

But biology students usually don’t learn the origins of this new knowledge. The feminist scientist’s name does not appear in most academic footnotes or citations. Instead, students learn that science is self-correcting – even if the correction in this case comes from outside the established. This means that the insights that feminist scientists bring to their field may become part of mainstream knowledge, but there is no trace of how they came about.

Clearly, science’s larger power structures need to update their understanding of how feminist science can help expand human knowledge and take credit for the ways it already has. Until then, there is one thing that scientists who deliberately address these prejudices can do. Erasing the term will only continue the cycle of dismissal and marginalization of feminist scientists and their key contributions to the field.

What about terms like feminist science that make some scientists uncomfortable? The seemingly out of nowhere model begins to fall apart when we admit that we can and indeed must balance looking hard and having deep convictions. It’s time for science to look at the possibilities and stop fearing the F-word. Only then can we widen our lens and begin to improve science for everyone.


Rachel E. Gross is a science journalist and author of Vagina Obscura: An Anatomical Voyage.



[ad_2]

Source link

Tagsbodycanonexplorefallhealthhistorylifelightlookmodelnewnewsperfecttimetreetrendviewwomanwomenwork
Previous Article

Compassion and medical fashion

Next Article

Oakland Tech Alumni Giving Back to Community ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    Maine Organization Receives Children’s Health Small Grant from Davis Foundation

    September 4, 2022
    By admin1
  • Fashion

    Yes, You Need Bermuda Shorts This Summer

    June 10, 2024
    By admin1
  • All

    Bruce Jones’ Seosundays offers SEO courses on a variety of digital marketing topics.Free His SEO Webinar Every Sunday Morning

    August 23, 2022
    By admin1
  • Health & Beauty

    Nature’s Wellness Elixir: A Closer Look at CBD Armour’s Organic CBD Oil

    February 10, 2024
    By admin1
  • Health & Beauty

    Dear Abby: I enjoy holiday entertaining, but not when my daughter’s in-laws come

    November 2, 2023
    By admin1
  • Health & Beauty

    Missouri doctor convicted of health system crimes

    August 26, 2022
    By admin1

You may interested

  • Science & Tech

    ‘Super/Natural’ proves scientific fact is stranger than fiction

  • Science & Tech

    Scientists break world record for most powerful and stable magnetic field : ScienceAlert

  • Science & Tech

    Scientists say these mysterious diamonds came from outer space

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Is ShopRite open on Memorial Day 2024?

    By admin1
    May 26, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy