Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

All
Home›All›Maxis Wins in E-Commerce and Digital Marketing Spaces, Proof of Success Delivering Business Results

Maxis Wins in E-Commerce and Digital Marketing Spaces, Proof of Success Delivering Business Results

By admin1
August 27, 2022
487
0
Share:

[ad_1]

subscribe telegram A channel for the latest stories and updates.


Over the years, Maxis has helped Malaysian companies establish and strengthen their digital presence. Its omni-channel commerce solutions include helping customers in the e-commerce industry with e-commerce and retail solutions such as web building, digital marketing, cloud hosting and POS solutions. All of this is combined with exclusive access to business advisory services and the Maxis Business Education Hub.

Maxis Business recently won an award for pushing these boundaries. eCommerce Marketing Agency of the Year At the annual A+M’S Agency of the Year (AOTY) and MARKies Awards. This includes his coveted AOTY Gold and Local Hero Awards in the e-commerce category and his contributions to effective e-commerce and digital marketing campaigns for several of our enterprise customers such as XXILI Intima, Fitness Concept and Mr. DIY. Includes several of his MARKies awards for efforts.

“We are honored and humbled to be recognized for the work we do to help our enterprise customers succeed in this digital world. As companies recognize the value of digitization, always ahead In this changing world,” said Claire Featherstone, deputy chief enterprise business officer at Maxis.

Below are details of the MARKies Awards we won.

  1. Silver: Best Use – Integrated Media: XXILI Intima
    • motion: Advocating body positivity for a perfect fit for everyone
  2. Silver: Most Effective Use – Specific Audience: Fitness Concept
    • motion: Fitspo Redefining: Strengthening the Nation One Fitness Goal at a Time
  3. Silver: Most Creative – Covid-19 Response: MR.DIY
    • motion: Crossing borders and reaching homes in Malaysia with the power of digital innovation
  4. Bronze: Most Creative – Digital: MR.DIY
    • motion: Crossing borders and reaching homes in Malaysia with the power of digital innovation

This is Maxis’ biggest win to date in the past three years of participating in the awards and reaffirms its consistent achievement of excellence for its enterprise customers.

A&M’s AOTY Awards are held annually and appoint an independent panel of senior marketers to identify outstanding performance of Malaysian marketing agencies. Recognition as a Gold and Local Hero in the eCommerce Marketing Agency of the Year category solidifies Maxis’ position in the tough competition in the ecommerce and digital marketing industry. Meanwhile, the MARKies Awards recognize exemplary marketing campaigns carried out by Malaysian brands, retailers and industry.


Let us know what you think on TRP Facebook. twitterand Instagram.



[ad_2]

Source link

TagsbestbodyBusinesscreativediyeducationfitfitnessfitspogoldinstagrammalaysiamarketingperfectpositivitysilversuccesstheworkworld
Previous Article

Science, Religion and Politics Collide as Nations ...

Next Article

DeSantis Insults Florida’s Public Education and Its ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    Pingree Sponsors Bill Aimed at Ensuring Equity in Medical Education Programs

    September 17, 2022
    By admin1
  • All

    Midwest Digital Marketing Conference Held Face-to-face at UMSL – UMSL Daily

    September 26, 2022
    By admin1
  • Science & Tech

    [Science Solitaire] we are literally polluting our minds right now

    November 27, 2022
    By admin1
  • Fashion

    John Travolta celebrates daughter Ella’s fashion show debut

    September 18, 2022
    By admin1
  • Health & Beauty

    The West End Health Foundation will award $30,000 to youth mental health programs around the Ishpeming area.

    September 2, 2022
    By admin1
  • Science & Tech

    Ohio to host science park for space research

    September 22, 2022
    By admin1

You may interested

  • Science & Tech

    Computer Scientist from Vietnam Wins Best Student Award at CSU

  • Science & Tech

    North Texas Giving Day Booster: University of North Texas Health Science Center Foundation

  • Science & Tech

    Learn to be an astronaut with space science research

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • England vs. Denmark FREE LIVE STREAM (7/28/23): Watch Women’s World Cup 2023 online | Time, ...

    By admin1
    July 28, 2023

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy