Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Fashion
Home›Fashion›Justice for Weird Barbie: Her Kookiness Makes Her Great

Justice for Weird Barbie: Her Kookiness Makes Her Great

By admin1
July 28, 2023
545
0
Share:

[ad_1]

Courtesy Warner Bros. Pictures

In Barbie Land, what happens when you’re not perfect?

By
Natalie Michie

Date July 28, 2023

Everyone who has played with dolls has a Weird Barbie origin story. Maybe you tried to give your doll some layers with dull kitchen scissors. Perhaps you were going for a sophisticated makeover by colouring her lips red with Sharpie. Before you knew it, your Stereotypical Barbie became Weird Barbie, and she was relegated to the bottom of your toy box. In the Barbie movie, we finally see her side of things. And it’s possibly the most important perspective to understand.

RELATED: Barbie Is Not Anti-Man at All, Actually

Alongside Margot Robbie clad in impeccable vintage Chanel outfits as the main character Barbie, Kate McKinnon’s Weird Barbie is the antithesis of an aspirational doll. Her roughly chopped hair juts out in every direction. Her face is tattooed with squiggly colourful pen marks. She wears paint-splattered clothes, she’s permanently in the splits, and she smells like “basement” (make of that what you will). Living in a lopsided house on the fringes of Barbie Land, Weird Barbie is a local outcast because, well, she’s no longer perfect.

Weird Barbie
Courtesy Warner Bros. Pictures

Compared to the other Barbies, whose costumes often stayed true to the Mattel catalogue, Weird Barbie’s style is…experimental. She wears two chaotically clashing ensembles: a puffy pink dress with a bright tulle hemline and yellow snakeskin boots during the first half of the movie, and a jacket with silver detailing and kaleidoscopic trousers in the second act. Unlike the cookie-cutter dolls, Weird Barbie’s aesthetic was described by costume designer Jacqueline Durran as “very high fashion and conceptual.” Playing with exaggerated proportions and loud colour blocking, her wardrobe looks like it was dreamed up by a child. It’s also reminiscent of something you might find on a fanciful couture runway. Visually, she’s hard to understand, so the other Barbies write her off. But her character — and everything she represents — is crucial.

The thing is, even though she’s seen as “ugly” (the worst imaginable insult if you’re a Barbie), she’s the doll with the most critical thinking skills, foresight, and knowledge of the real world. After being socially discarded for losing her once-ideal image, she’s gained wisdom that helps the other Barbies navigate the film’s conflicts. Not to mention, she’s the only doll not to be brainwashed when (spoiler!) the villainous Kens briefly take over. Despite making her a reject, her kookiness makes her great. The same goes for all the mangled Barbies lost in basements.

Weird Barbie is so much more than a doll you light on fire as a kid drunk with power. Branded in the film as a toy that has been played with “too hard,” she’s emblematic of childhood whimsy. “It’s imagination,” McKinnon said in an interview discussing the process of mutilating a doll. “It’s a way of expressing your innermost desires and things that you’re exploring about yourself and the world.” At her core, Barbie bears the built-in expectations of womanhood: impossible body proportions; an always-amazing sense of style; effortless popularity. Tossing her in the microwave and dunking her hair in Wite-Out is certainly one way of pushing back on those pressures.

After all, we’re all closer to being Weird Barbie than Stereotypical Barbie. Her experiences — feeling like you don’t belong, being ostracized for your differences, blurting out awkward comments at the wrong time — are gloriously relatable, unlike Barbie’s commercialized image. Weird Barbie, in all her “unladylike” traits, is a symbol of rejecting beauty norms and framing femininity on your own terms. In the film, she’s been received as an allegory for those who have intersecting identities — with some women who are queer, plus size, and neurodivergent sharing that they feel a kinship with her.

Ultimately, every Weird Barbie is deeply personal. She’s not just some rare collector’s item like Allan or Midge. No one buys a Weird Barbie, you make her. She’s the manifestation of unbridled creativity, a dash of frustration, and, yeah, a bit of freakiness. The Barbie movie invites us not only to reconcile with the doll we once disfigured and tossed aside, but to also find her in ourselves.



[ad_2]

Source link

Tagsaestheticamazingbeautybodychanelclothesdesignerdressfashionfilmhairlightperfectpinkredstylevintagewomenworldyellow
Previous Article

What you missed from Crocs, Mattel and ...

Next Article

Sweden vs. Italy FREE LIVE STREAM (7/29/23): ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • All

    Huawei South Africa Opens Recruitment for 2022 Female Tech Entrepreneur Digital Skills Training Program

    September 16, 2022
    By admin1
  • Fashion

    Quiet Luxury Brands That Give Stealth Wealth On a Budget

    November 14, 2023
    By admin1
  • Fashion

    How the Internet Turned Dadcore Classic ‘Afraid of Fish’ into Viral Fashion

    August 30, 2022
    By admin1
  • Fashion

    Queen Elizabeth, a fashion icon? yes.

    September 9, 2022
    By admin1
  • Travel & Lifestyle

    BUSD Adopts Several Resolutions At School Board Meeting

    September 8, 2022
    By admin1
  • Travel & Lifestyle

    WFP and Ministry of Education complete first nutrition summer camp in occupied Palestinian territory Palestine

    August 19, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    In Africa, TV programs teaching science to children are on the rise due to COVID

  • Science & Tech

    New Army space plan anticipates ‘operator’-level space capabilities, general says

  • Science & Tech

    Creator of Johns Hopkins COVID tracker wins US top science award | Coronavirus pandemic news

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • The Salvation Army’s Reimagine 75: Fashion with a Cause Event

    By admin1
    September 27, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy