Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

      May 18, 2025
      0
    • Travel in Style and Comfort with Europcar’s Wide Range of Premium Vehicles

      May 18, 2025
      0
    • From Business Trips to Scenic Escapes – Europcar Delivers Every Time

      May 18, 2025
      0
    • Experience Seamless Mobility Across Continents with Europcar’s Global Fleet

      May 18, 2025
      0
    • Unlock Limitless Travel Possibilities with Europcar’s Flexible Rental Solutions

      May 18, 2025
      0
    • Unwind in Style: Discover the Luxury and Charm of the QHotels Collection ...

      May 15, 2025
      0
    • Experience The Heart Of The City Through Cutting-Edge Interactive Technology

      May 15, 2025
      0
    • Enjoy Seamless Luxury and Excitement at Caesars Rewards Most Prestigious Vegas Locations

      May 15, 2025
      0
    • Discover Top Campgrounds Near Iconic National Parks for the Ultimate Outdoor Adventure

      May 11, 2025
      0
  • Fashion
    • L'ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

      May 18, 2025
      0
    • Erhöhen Sie Ihr Schuhspiel: Herren-Barfußstiefel von Groundies

      May 15, 2025
      0
    • Treten Sie ein in die Welt minimalistischer Barfußschuhe für ultimative Freiheit und ...

      May 15, 2025
      0
    • Luis Trenker Kleider: Entworfen für Frauen, die sich trauen, aufzufallen

      May 14, 2025
      0
    • Laufen bei jedem Wetter: Entdecken Sie die besten Laufjacken bei Laufbar

      May 14, 2025
      0
    • Laufen mit Komfort und Stil: Entdecken Sie die besten Laufschuhe bei Laufbar

      May 14, 2025
      0
    • Améliorez votre condition physique avec Myprotein : Les meilleures ventes de vêtements ...

      May 10, 2025
      0
    • Elevate Your Wardrobe with Fruugo: A Vast Selection of Women’s Shoes for ...

      May 8, 2025
      0
    • Enhance Your Golf Game and Style with Premium Men’s Headwear from Discount ...

      May 5, 2025
      0
  • Health & Beauty
    • L'ARISÉ Damenduftkollektion: Eleganz in jeder Note

      May 19, 2025
      0
    • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

      May 19, 2025
      0
    • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

      May 19, 2025
      0
    • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

      May 18, 2025
      0
    • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

      May 18, 2025
      0
    • Fitness Trifft Innovation: Die Speediance Revolution Beginnt Jetzt

      May 15, 2025
      0
    • Erleben Sie die Kraft natürlicher Inhaltsstoffe in den MiiN-Körpercremes

      May 15, 2025
      0
    • Vom Bauernhof zur Verpackung: Das Engagement von Lucky Hemp für hochwertige CBD-Blüten

      May 15, 2025
      0
    • Verbessern Sie Ihre Hautpflege mit den Premium-Gesichtsseren von MiiN

      May 15, 2025
      0
  • Science & Tech
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
    • Revolution beim Kochen im Freien: Rüsten Sie sich mit Ration1.de Essentials

      December 23, 2024
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

  • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

  • Explore Casetify’s Durable and Customizable iPhone 16 Pro Max Cases

  • Camif : Solutions de mobilier durable pour des espaces de vie élégants et fonctionnels

  • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

  • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

  • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

All
Home›All›Sivanand SEO Experts in Hyderabad offers free digital marketing training, paid internships and job opportunities.

Sivanand SEO Experts in Hyderabad offers free digital marketing training, paid internships and job opportunities.

By admin1
September 3, 2022
319
0
Share:

[ad_1]

Indian SEO Expert - Shivanand

Indian SEO Expert – Shivanand

Hyderabad SEO Expert

Best SEO Expert in Hyderabad

Dubai SEO Expert - Shivanand SEO

Dubai SEO Expert – Shivanand SEO

Young aspirants can seize this lifetime opportunity to improve their digital marketing skills and become experts in the new era of the digital landscape.

Digital marketing is an investment, not an expense. The future of marketing is digital and social. ”

— Sivanand SEO

HYDERABAD, Telangana, India, Sept. 3, 2022 /EINPresswire.com/ — The marketing industry has undergone a major transformation in the last decade, and the scope of digital marketing has expanded exponentially. With the majority of people using the internet, businesses are now focusing on digital marketing to increase productivity and reduce traditional marketing costs. This enables a large number of students to study digital marketing, take advantage of the course benefits, and gain lucrative employment opportunities in the expanding field of digital marketing.

A renowned SEO expert from Hyderabad, Shivanand Machandra has been a dominant player in the digital marketing sector for over a decade, building a huge customer base around the world. He offers his free Digital Marketing training to career-focused aspirants to secure a promising career in the dynamic realm of SEO and digital marketing. This he will have three months of free digital marketing training followed by a paid internship to learn real world scenarios by working on real projects. After successful completion of the internship period, the candidate will be given a LOR and a certificate and a permanent employment opportunity.

“The market is highly competitive,” Shivanand said. Acquiring a skill is never a bad thing, it just means you can find a more stable, higher paying job after you have acquired such a highly sought-after skill.”

Businesses are well aware of the benefits of digital marketing, especially since the pandemic. You can grow your business further, attract more audiences, and increase your revenue through digital marketing. Digital marketing campaigns come with a variety of responsibilities, such as creating your business’s online presence, managing your advertising campaigns, and creating your content strategy to deliver the desired results. However, these operations require a qualified digital marketing specialist. As a result, the demand for these talents in the market will increase.

Shivanand has a working knowledge of all aspects of digital marketing and search engine optimization. He has expanded the scope of his business beyond India and is currently working on numerous overseas projects with many exclusive clients around the world. He is also an SEO expert in Dubai and worked in Dubai for 3 years as a digital marketing and SEO expert in the real estate industry. His hand-picked talented team of professionals is driven by their work and considers every possibility to achieve client satisfaction. The best at his job, he came up with the idea of ​​offering free digital his marketing courses, paid internships, and employment opportunities to help students advance their careers. By training others to do the same, he contributes to a market where more people thrive.

Shivanand said: “In my 10+ years of life as an SEO and digital marketing professional, I have dedicated myself to delivering immeasurable growth and results to my clients by putting my best efforts into action. ‘s hard work and passion have earned me the title of one of the leading Freelance Digital Marketers and SEO Experts in India today.From now on, I will dedicate my life to leading the future of digital marketing. We want to share our insights and learnings with up-and-coming talent.”

He further describes his course program as follows: My training classes are aimed at strengthening the fundamentals of digital marketing. Paid internships are designed to allow interns to put their learning into hands-on projects to understand real-world scenarios. Excellent throughout the training internship period. So take your chance and be part of my team. ”

Shivanand’s passion has made him one of the best SEO specialists on the market. He believes in giving his customers more than they expect. He consistently works with his team to create something new to be more successful. While he is renowned for his ethical terms, Sivanand has a track record of many project completions, customer satisfaction, and trust. He has obtained various of his SEO certificates from the most reputable organizations and has managed to become one of the top his SEO Practitioner and Digital Marketer in India.

Finally, he would like to send a short message to his young fellows. Connect with me and let me guide you towards a successful career in the world of digital marketing. ”

About Sivanand Machandra:
India’s experienced and top SEO professionals are best known for their professional standards of work with domestic and international clients. With his 10+ years of experience in agency and his trainer background in digital marketing. He turns websites into valuable assets through his solid SEO and his 360° creative digital marketing techniques. His optimistic and streamlined strategy will help local and international brands generate more organic traffic and generate more leads in their customer revenue stream. , the United Arab Emirates, the UK and small businesses around the world.

His mission is to build a team of highly skilled digital marketing professionals and create a flexible work environment where everyone can connect, work under his leadership and be well paid. I’m doing it.

Below is the perfect answer to the question “Who is Sivanand?”
– Experienced and Top SEO Experts in India
– Passion by DigiPreneur, Digital Marketing Trainer, Vlogger]
– Contributor, Institute of Digital Marketing, Mumbai, India]
– Responsible and caring family man who loves his family and daughter unconditionally.
– Dedicated professionals who deliver the best results.

For more information, please visit https://www.shivanandseo.com/about/.

Sivananda Machandra
Sivanand SEO
+91 91724 94919
info@shivanand.in
Visit us on social media:
Facebook
twitter
LinkedIn
other

you just read:

news source

3 September 2022 14:53 GMT


EIN Presswire’s priority is source transparency. We do not allow opaque clients and our editors are careful to remove false and misleading content. Your help is greatly appreciated. EIN Presswire (Everyone’s Internet News Presswire™) seeks to define some of the boundaries of reason in today’s world. See our Editorial Guidelines for more information.

Submit a press release



[ad_2]

Source link

TagsbestBusinesscreativedubaifamilyindialandscapelifemarketingmemynewpassionperfectsharetoptrainingukworkworld
Previous Article

Uvalde High School wins football game in ...

Next Article

When should you use your TV over ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    Laundry Day Solutions: Must-Have Spares & Accessories for Your AEG Washer

    February 17, 2024
    By admin1
  • Climate Action Africa, Our Lady Queen of Nigeria Pilot ‘Faith for Climate Action’

    August 30, 2023
    By admin1
  • Travel & Lifestyle

    The pandemic has boosted private education, but will security do the same?

    September 15, 2022
    By admin1
  • Fashion

    How will the Queen’s death affect London Fashion Week?

    September 11, 2022
    By admin1
  • Fashion

    Meghan looks to the future in outfit for activist fashion brand Summit

    September 6, 2022
    By admin1
  • Health & Beauty

    Northside restaurant fails health check

    September 23, 2022
    By admin1

You may interested

  • Science & Tech

    Fagerhult Group commits to Science Based Targets initiative

  • Science & Tech

    Data science and analytics executives in high demand

  • Science & Tech

    AI that designs proteins may discover new treatments and materials unknown to science

Search

Categories

  • All (1,238)
  • Animal Food (17)
  • Books & Novels (14)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (6)
  • Export Test (21)
  • Fashion (1,690)
  • Fitness & Health (17)
  • Food & Drinks (15)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,575)
  • Health & Beauty (20)
  • Home&Living (206)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (3)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,344)
  • Sports (21)
  • Technology (150)
  • Travel & Lifestyle (5)
  • Travel & Lifestyle (1,609)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

    By admin1
    May 19, 2025
  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

    By admin1
    May 19, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Hannaford Announces Donation to Franklin Community Health Network

    By admin1
    September 14, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy