Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›Sexual Health Awareness Month (2022) – District Health Department 10

Sexual Health Awareness Month (2022) – District Health Department 10

By admin1
September 1, 2022
468
0
Share:

[ad_1]

important facts

According to the World Health Organization:

  • Sexually transmitted diseases have direct impacts on sexual and reproductive health through stigma, infertility, cancer, pregnancy complications, and can increase the risk of HIV.
  • There is no cure for HIV infection. However, as access to effective HIV prevention, diagnosis, treatment and care, including opportunistic infections, increases, HIV infection will become a manageable chronic disease and people living with HIV will live longer and healthier lives. Now you can.
  • Most herpes infections are asymptomatic, but herpes symptoms include painful blisters and sores that can recur over time.

The American Health Association defines sexual health as the ability to embrace and enjoy sexuality throughout life. According to the World Health Organization, it is a state of physical, emotional, mental, and social well-being associated with sexuality, not merely the absence of disease, impairment, or infirmity. We need a positive and respectful approach to sexual relationships, as well as the possibility of an enjoyable and safe sexual experience free from coercion, discrimination and violence.

Being sexually healthy means:

  • Understand that sexuality is a natural part of life and includes more than sex.
  • We recognize and respect sexual rights that we all share.
  • Access to sexual health information, education and care.
  • Strive to prevent unwanted pregnancies and sexually transmitted infections (STIs) and seek care and treatment when needed.
  • Being able to experience sexual pleasure, satisfaction, and intimacy on demand.
  • Communicate with others, including sexual partners and health care providers, about sexual health.

Sexual health is recognized as an important strategy for promoting overall health and well-being, including:

  • family planning
  • sexually transmitted disease
  • Human Immunodeficiency Virus (HIV)/AIDS
  • reproductive health
  • sexual risk behavior

Talking with your health care provider about your sexual health can be intimidating. You may not want to admit certain feelings or fears about your health. However, being able to talk to your health care provider about your physical health is very important as it relates to your sexual health.

family planning

District Health Department #10 Family Planning Program provides low-cost or free quality reproductive health care for women, men and teens. Family planning is a public health service that helps individuals and families plan the desired family size and spacing of children, and helps prevent unwanted pregnancies. On DHD#10 find:

  • Information about contraception and sexual health
  • Helps you choose the best contraceptive method your life
  • Helps you plan a healthy pregnancy when you want a baby
  • pregnancy test and counseling
  • STD testing and treatment
  • Preventive health checks to screen for cancer and other health problems
  • Services are charged based on ability to pay
  • You can use insurance, including Medicaid

A happy and healthy sex life starts with getting tested. Yes, STD testing is also an important part of sexual health. Anyone who has multiple sexual partners, believes they may have been infected, has had unprotected sex with a partner whose health status is unknown, or has symptoms of an STD should be tested. there is.

STI

  • More than 1 million STIs are infected every day worldwide.
  • An estimated 374 million people are newly infected each year with one of four STIs: chlamydia, gonorrhea, syphilis, and trichomoniasis.
  • Most STDs have no symptoms or only mild symptoms that may not be recognized as STDs.
  • It is estimated that over 500 million people between the ages of 15 and 49 have genital infections caused by the herpes simplex virus (HSV) (1).

If you think you have an STD, don’t panic in the first place. You should make an appointment to be tested immediately and abstain from sexual activity until you have been tested.To make a reservation call 888-217-3904, then option #2. After the test results, the nurse can discuss safe-her sex, treatment options, birth control, how to talk to your partner, and more. If you have any questions, please feel free to contact us.

HIV/AIDS

  • HIV has claimed more than 35 million lives to date and remains a major global public health problem. In 2016, 1 million of her died worldwide from HIV-related causes.
  • Currently, 54% of adults and 43% of children living with HIV receive lifelong antiretroviral therapy (ART).
  • Global ART coverage for pregnant and lactating women living with HIV is high at 76%.
  • Key populations are groups at high risk of HIV, regardless of epidemic type or local context. They include men who have sex with men, people who inject drugs, people in prisons and other closed environments, sex workers and their clients, and transgender people.
  • There is no cure for HIV infection. However, effective antiretroviral (ARV) drugs can help control the virus and prevent infection. This allows people living with HIV and those at significant risk to enjoy a long, healthy and productive life.

DHD#10 offers confidential STI and HIV testing. Anyone, including teenagers, can be tested for a small fee or for free (fees vary depending on income). DHD#10 can also claim insurance to cover the cost of the service. DHD#10’s service is LGBTQ friendly.

Quick Links:

DHD#10 – Sexual Health
ASHA – Commitment to Improving Sexual Health
WHO – Fact Sheet on Sexually Transmitted Diseases
CDC – Reproductive Health
CDC – Sexual Risk Behavior
CDC – About HIV
CDC – About AIDS



[ad_2]

Source link

Tagsartbabybestdayeducationenjoyfamilyhappyhealthhealthylifelivemennaturalpeoplesharethetimewomenworld
Previous Article

‘Effective Solutions:’ Virginia Education Association Addresses Teacher ...

Next Article

Fashion Impressions: What to Wear to Say ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    Milwaukee sci-fi writer falls victim to ‘swatting’

    August 16, 2022
    By admin1
  • Health & Beauty

    Should citizens pay for oil and gas profits in good health?

    September 17, 2022
    By admin1
  • Health & Beauty

    Press Briefing by White House Monkeypox Response Team and Public Health Officials

    September 16, 2022
    By admin1
  • Science & Tech

    Amazon Japan prohibits “harmful books” written by “Dr.” Stone’ Science Consultation Team

    September 8, 2022
    By admin1
  • Health & Beauty

    Embrace Individuality: Explore Sunnamusk’s Men’s Fragrance Collection

    January 4, 2025
    By admin1
  • Fashion

    Check Out the Best Celebrity Halloween Costumes of 2023

    October 30, 2023
    By admin1

You may interested

  • Science & Tech

    Anduril buys drone maker Blue Force Technologies amid Pentagon push for autonomous aircraft

  • Science & Tech

    How Rise Science Founder Jeff Kahn Manages Sleep Debt

  • Science & Tech

    Discrimination causes an almost instant spike in stress hormones.chemistry

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • How did you get so bad?Parents and teachers worry about schools for students with disabilities

    By admin1
    September 19, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy