Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

      May 18, 2025
      0
    • Travel in Style and Comfort with Europcar’s Wide Range of Premium Vehicles

      May 18, 2025
      0
    • From Business Trips to Scenic Escapes – Europcar Delivers Every Time

      May 18, 2025
      0
    • Experience Seamless Mobility Across Continents with Europcar’s Global Fleet

      May 18, 2025
      0
    • Unlock Limitless Travel Possibilities with Europcar’s Flexible Rental Solutions

      May 18, 2025
      0
    • Unwind in Style: Discover the Luxury and Charm of the QHotels Collection ...

      May 15, 2025
      0
    • Experience The Heart Of The City Through Cutting-Edge Interactive Technology

      May 15, 2025
      0
    • Enjoy Seamless Luxury and Excitement at Caesars Rewards Most Prestigious Vegas Locations

      May 15, 2025
      0
    • Discover Top Campgrounds Near Iconic National Parks for the Ultimate Outdoor Adventure

      May 11, 2025
      0
  • Fashion
    • Explore Casetify’s Durable and Customizable iPhone 16 Pro Max Cases

      May 19, 2025
      0
    • L'ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

      May 18, 2025
      0
    • Erhöhen Sie Ihr Schuhspiel: Herren-Barfußstiefel von Groundies

      May 15, 2025
      0
    • Treten Sie ein in die Welt minimalistischer Barfußschuhe für ultimative Freiheit und ...

      May 15, 2025
      0
    • Luis Trenker Kleider: Entworfen für Frauen, die sich trauen, aufzufallen

      May 14, 2025
      0
    • Laufen bei jedem Wetter: Entdecken Sie die besten Laufjacken bei Laufbar

      May 14, 2025
      0
    • Laufen mit Komfort und Stil: Entdecken Sie die besten Laufschuhe bei Laufbar

      May 14, 2025
      0
    • Améliorez votre condition physique avec Myprotein : Les meilleures ventes de vêtements ...

      May 10, 2025
      0
    • Elevate Your Wardrobe with Fruugo: A Vast Selection of Women’s Shoes for ...

      May 8, 2025
      0
  • Health & Beauty
    • L'ARISÉ Damenduftkollektion: Eleganz in jeder Note

      May 19, 2025
      0
    • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

      May 19, 2025
      0
    • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

      May 19, 2025
      0
    • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

      May 18, 2025
      0
    • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

      May 18, 2025
      0
    • Fitness Trifft Innovation: Die Speediance Revolution Beginnt Jetzt

      May 15, 2025
      0
    • Erleben Sie die Kraft natürlicher Inhaltsstoffe in den MiiN-Körpercremes

      May 15, 2025
      0
    • Vom Bauernhof zur Verpackung: Das Engagement von Lucky Hemp für hochwertige CBD-Blüten

      May 15, 2025
      0
    • Verbessern Sie Ihre Hautpflege mit den Premium-Gesichtsseren von MiiN

      May 15, 2025
      0
  • Science & Tech
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
    • Revolution beim Kochen im Freien: Rüsten Sie sich mit Ration1.de Essentials

      December 23, 2024
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

  • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

  • Explore Casetify’s Durable and Customizable iPhone 16 Pro Max Cases

  • Camif : Solutions de mobilier durable pour des espaces de vie élégants et fonctionnels

  • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

  • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

  • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

Fashion
Home›Fashion›Selena Gomez Relationship Drama: Everything We Know So Far

Selena Gomez Relationship Drama: Everything We Know So Far

By admin1
December 11, 2023
271
0
Share:

[ad_1]

Photography by Getty Images

The singer and actress found herself in some hot water over the weekend after details about her new relationship status were revealed.

By
Stephanie Davoli

Date December 11, 2023

No one does social media drama quite like Selena Gomez. The singer has been known to announce Instagram hiatuses that she may or may not always follow through on (which, relatable) and publicly react to perceived shade. But she recently got into some new hot water online after announcing her relationship with music producer Benny Blanco. So why has this budding romance already caused such a stir? We have all the details on Gomez and Blanco’s drama-inducing relationship so far — and settle in because there’s a lot to discuss.

Who is Benny Blanco?

After Gomez confirmed her romance, the first question on everyone’s minds naturally seemed to be, who exactly is Benny Blanco?

According to Business Insider, Blanco is a prominent music producer who has worked with notable entertainers such as Rihanna, Maroon 5, Halsey, Gomez herself and yes, her famous ex, Justin Bieber (more on that later).

In addition to producing her latest song, ironically titled “Single Soon,” Blanco has worked with Gomez to create some of her biggest hits, including “Same Old Love” and “Kill ‘Em With Kindness,” which were released in 2015 and 2017, respectively.

When did Selena Gomez and Benny Blanco start dating?

The exact timeline of the new couple’s relationship is blurry, but Gomez did let fans in on some details when she publicly announced the romance through a series of Instagram interactions on December 7.

It all began when Gomez liked a post from the celebrity news Instagram account @popfactions which addressed rumours that she had started dating Blanco. This interaction then prompted the media website to share another post stating that Gomez had seemingly confirmed the relationship, to which the singer then commented “Facts.” Enough said.

Soon after, Gomez hard-launched the relationship on her Instagram story, posting a photo that had her snuggling into Blanco’s shoulder. Afterwards, the Rare Beauty founder wrote “[Blanco] is my absolute everything in my heart” in a separate @popfactions post. 

Photography courtesy of @selenagomez on Instagram

After confirming her updated relationship status through both the social media interactions and her own Instagram story post, Gomez responded to a fan’s comment on Instagram revealing that she and Blanco have been together for six months (there seem to be inconsistencies with this timeline — more on that later as well).

Are they engaged?

If news travels fast on social media then rumours must fly at lightning speed, because just a day after Gomez confirmed her new relationship, murmurs of the pair being engaged were already swirling. This began after Gomez shared another Instagram story  showcasing a “B” wrap ring on her left hand’s ring finger on December 8.

Though Gomez didn’t respond to any of the engagement comments, she was also seen wearing the ring when she stepped out in New York City that same day. According to Page Six, the piece is a custom Jacquie Aiche design and features .44 carats of pavé diamonds.

Why are people upset with Selena?

Although some fans were happy for the star and her new romance, others didn’t share the same feelings. Fans quickly took to @popcrave’s comment section to voice their disapproval of the relationship, especially since Blanco had allegedly spoken badly about Gomez in the past.

Not one to shy away from an upsetting comment or two, Selena Gomez began responding to the drama and fans’ criticisms, going as far as to respond to some by saying “If you can’t accept me at my happiest then don’t be in [my] life at all.”

@kierabreaugh #selenagomez #bennyblanco ♬ original sound – Kiera Breaugh

Soon after, people began to call out Gomez for what they perceived as hypocrisy. This included fans sharing receipts of when Gomez was caught liking shady comments about the Biebers on Instagram and TikTok. A few followers also brought up an old Instagram screenshot that showed Gomez being critical of Justin for defending his then-girlfriend against haters on Instagram, telling him to “stop posting pictures of your girlfriend” if he couldn’t handle the hate. People quickly noted that Gomez’s defence of Blanco on social media seemed to be in direct opposition to the old advice she gave to Bieber in the screenshot.

Then came the aforementioned timeline issue. Speculation on social media suggested that, if Gomez had indeed been dating Blanco for six months, the star wasn’t actually single while she was promoting her latest song, “Single Soon,” (which, as the title suggests, is about celebrating single life). Why does this matter, you ask? Because Gomez has made being single a fundamental part of her branding — posting TikToks and even selling merchandise that promoted this narrative — many of her followers feel as though they’ve been lied to.

How is Taylor Swift involved?

After confirming her new relationship status on Thursday night, Gomez joined her bestie Taylor Swift as well as other friends Cara Delevingne, Anya Taylor-Joy and Zoë Kravitz for a girls’ night out in New York City.

Why is a dinner causing so much fuss? Well, fans have noticed a trend that has connected many of her recent public outings with Swift. Apparently, after Gomez has been caught in drama on social media, it’s become common for her to be seen hanging out with Swift the next day. Some social media users have speculated that these conveniently timed hangouts are done to benefit Gomez with some positive PR. (It’s worth noting that Gomez and Swift have long been genuinely good friends. So, to be fair, the timing of these outings could be purely coincidental.)

Regardless of all the online drama, Gomez seems to be stress-free IRL. While she was defending her relationship with Blanco under the @popcrave post, the actress shared that she’s planning on taking a break from social media until she has to use her platforms for work purposes again.

Wherever this story goes, we’ll be sure to keep an eye out for new updates on Selena Gomez and any other drama that comes her way in the coming weeks. And in the meantime, perhaps we can all just let her dine out in peace.

More Celebrity

Celebrity

By
Meaghan Wray

Date November 29, 2023

Celebrity

By
Natalie Michie

Date August 15, 2023

Celebrity

By
Isabel B. Slone

Date August 15, 2023



[ad_2]

Source link

TagsbeautyBusinessdesigndinnerfollowfriendsgirlshappyinstagramlifelovememusicnewnightphotophotographytiktokweekendwork
Previous Article

Elevating Youth Voice in Learner-Centered School Quality ...

Next Article

Apply For Workplace Women Pitch-A-Fix (₦50M)

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • All

    Digital Marketing Expert Matt Tarrant – Get more reviews and success for your business

    September 6, 2022
    By admin1
  • Travel & Lifestyle

    State Board of Education Launches Strategic Plan Engagement SurveyNEWS

    September 4, 2022
    By admin1
  • Travel & Lifestyle

    Explore Nere Travel Bags Collection: Stylish, Durable, and Perfect for Adventures

    December 13, 2024
    By admin1
  • Fashion

    LFW concludes with a melancholic Richard Quinn collection dedicated to the Queen.london fashion week

    September 20, 2022
    By admin1
  • Health & Beauty

    Dear Abby: Man’s laissez-faire attitude toward his health worries his wife

    August 25, 2023
    By admin1
  • All

    How to organize a goal-focused marketing team

    September 15, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Three Materials Science Graduate Students Win Elite NSF Fellowships

  • Science & Tech

    Army’s new training simulator on track for delivery in 2024

  • Science & Tech

    A Physicist’s Life Inspires Science Students

Search

Categories

  • All (1,238)
  • Animal Food (17)
  • Books & Novels (14)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (6)
  • Export Test (21)
  • Fashion (1,691)
  • Fitness & Health (17)
  • Food & Drinks (15)
  • Gift Guides (52)
  • Gift Guides (24)
  • Health & Beauty (1,575)
  • Health & Beauty (20)
  • Home&Living (206)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (3)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,344)
  • Sports (21)
  • Technology (149)
  • Travel & Lifestyle (5)
  • Travel & Lifestyle (1,609)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

    By admin1
    May 19, 2025
  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

    By admin1
    May 19, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Unlock Your Potential: Nourishing Well-being with Vitabiotics Multivitamins

    By admin1
    January 30, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy