Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

      May 18, 2025
      0
    • Travel in Style and Comfort with Europcar’s Wide Range of Premium Vehicles

      May 18, 2025
      0
    • From Business Trips to Scenic Escapes – Europcar Delivers Every Time

      May 18, 2025
      0
    • Experience Seamless Mobility Across Continents with Europcar’s Global Fleet

      May 18, 2025
      0
    • Unlock Limitless Travel Possibilities with Europcar’s Flexible Rental Solutions

      May 18, 2025
      0
    • Unwind in Style: Discover the Luxury and Charm of the QHotels Collection ...

      May 15, 2025
      0
    • Experience The Heart Of The City Through Cutting-Edge Interactive Technology

      May 15, 2025
      0
    • Enjoy Seamless Luxury and Excitement at Caesars Rewards Most Prestigious Vegas Locations

      May 15, 2025
      0
    • Discover Top Campgrounds Near Iconic National Parks for the Ultimate Outdoor Adventure

      May 11, 2025
      0
  • Fashion
    • L'ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

      May 18, 2025
      0
    • Erhöhen Sie Ihr Schuhspiel: Herren-Barfußstiefel von Groundies

      May 15, 2025
      0
    • Treten Sie ein in die Welt minimalistischer Barfußschuhe für ultimative Freiheit und ...

      May 15, 2025
      0
    • Luis Trenker Kleider: Entworfen für Frauen, die sich trauen, aufzufallen

      May 14, 2025
      0
    • Laufen bei jedem Wetter: Entdecken Sie die besten Laufjacken bei Laufbar

      May 14, 2025
      0
    • Laufen mit Komfort und Stil: Entdecken Sie die besten Laufschuhe bei Laufbar

      May 14, 2025
      0
    • Améliorez votre condition physique avec Myprotein : Les meilleures ventes de vêtements ...

      May 10, 2025
      0
    • Elevate Your Wardrobe with Fruugo: A Vast Selection of Women’s Shoes for ...

      May 8, 2025
      0
    • Enhance Your Golf Game and Style with Premium Men’s Headwear from Discount ...

      May 5, 2025
      0
  • Health & Beauty
    • L'ARISÉ Damenduftkollektion: Eleganz in jeder Note

      May 19, 2025
      0
    • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

      May 19, 2025
      0
    • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

      May 19, 2025
      0
    • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

      May 18, 2025
      0
    • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

      May 18, 2025
      0
    • Fitness Trifft Innovation: Die Speediance Revolution Beginnt Jetzt

      May 15, 2025
      0
    • Erleben Sie die Kraft natürlicher Inhaltsstoffe in den MiiN-Körpercremes

      May 15, 2025
      0
    • Vom Bauernhof zur Verpackung: Das Engagement von Lucky Hemp für hochwertige CBD-Blüten

      May 15, 2025
      0
    • Verbessern Sie Ihre Hautpflege mit den Premium-Gesichtsseren von MiiN

      May 15, 2025
      0
  • Science & Tech
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
    • Revolution beim Kochen im Freien: Rüsten Sie sich mit Ration1.de Essentials

      December 23, 2024
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

  • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

  • Explore Casetify’s Durable and Customizable iPhone 16 Pro Max Cases

  • Camif : Solutions de mobilier durable pour des espaces de vie élégants et fonctionnels

  • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

  • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

  • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

All
Home›All›New academy will teach digital skills to 1,000 people by 2025

New academy will teach digital skills to 1,000 people by 2025

By admin1
August 23, 2022
273
0
Share:

[ad_1]

media tech

A Manchester-based investment platform is launching an all-new academy to train 1,000 digital skills over the next three years.

Fearless Adventures’ Fearless Academy, founded by former Social Chain co-founder Dominic McGregor with David Newns and Charlie Yates, will launch its first bootcamp in September.

Develop, mentor and develop people looking to retrain and upskill in all areas of digital.

Trio of top entrepreneurs launch multi-million pound fund

Bootcamp specializations include SEO, PPC, graphic design, web development, and more.

The instructors are all seasoned marketing professionals from Fearless Adventures who have supported various high-growth global brands such as THG, Unilever, E!, Aldi, Logitech, and Superdry.

The Fearless Adventures talent team, led by Alex Hayes, will also help students find employment after completing the 12-week course.

From helping them prepare for interviews to hosting career days where students can network with potential employers, they welcome their employment prospects.

The co-founders of Fearless Academy have spent the last 20 years at the forefront of the digital marketing industry, building and scaling global businesses such as Manchester-headquartered Social Chain and Liverpool-based Neldia.

“Life after Social Chain” – Dominic McGregor

Both McGregor and Newns took different paths to business success. The former dropped out of college and the latter bypassed college to found and grow a digitally driven global company.

Today, they not only have a large network of professionals looking for talent, they also source talent for their investments on their venture capital platform, Fearless Adventures.

McGregor explains: But now more than ever, sourcing the right talent is becoming one of the biggest problems companies face. The real skill gap of a digital marketing professional is always widening. Our mission is to reverse this trend by upskilling the next generation of ambitious talent. ”

Fearless Adventures is a new kind of venture capital platform that not only injects capital into the D2C (Direct-to-Consumer) businesses it invests in, but also supports them with best-in-class digital marketing and top-flight digital talent. . they scale.

[ad_2]

Source link

TagsbestbuildingBusinessdesignfacegraphiclifemarketingnewpeoplesuccessteamthetodaytoptraintrend
Previous Article

Brexit’s inevitable gravity weighs on UK scientists

Next Article

The Bookseller – News – Restructuring PRH ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    Michigan health system uses AI technology to monitor chronic disease

    August 22, 2022
    By admin1
  • Health & Beauty

    Enhance Your Glow With Rodial’s Highlighters And Radiant Skin Care

    December 9, 2024
    By admin1
  • Health & Beauty

    Durex Condoms: Experience Comfort, Reliability, and Sensuality

    November 19, 2023
    By admin1
  • Health & Beauty

    Health Board Review Tobacco Violation | News

    September 3, 2022
    By admin1
  • Health & Beauty

    California protects health benefits of young immigrants

    August 23, 2022
    By admin1
  • Fashion

    Ayo Edebiri’s Style Isn’t Just Chic — It’s A Message On Power

    January 16, 2024
    By admin1

You may interested

  • Science & Tech

    Minister of Education, Culture, Sports, Science and Technology Igor Papich attends the Science, Technology and Society Forum in Kyoto from 29 September to 4 October 2022

  • Science & Tech

    Sudan’s descent into chaos sets stage for al-Qaida to return to a stronghold

  • Science & Tech

    Integral Ad Science Appoints Megan Reichelt as Country Manager for Southeast Asia

Search

Categories

  • All (1,238)
  • Animal Food (17)
  • Books & Novels (14)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (6)
  • Export Test (21)
  • Fashion (1,690)
  • Fitness & Health (17)
  • Food & Drinks (15)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,575)
  • Health & Beauty (20)
  • Home&Living (206)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (3)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,344)
  • Sports (21)
  • Technology (150)
  • Travel & Lifestyle (5)
  • Travel & Lifestyle (1,609)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

    By admin1
    May 19, 2025
  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

    By admin1
    May 19, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Power Up Your Life: BLUETTI’s Expansion Batteries Overview

    By admin1
    December 1, 2023

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy