Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›Manage your brain health and cognition easily with these simple tips – News

Manage your brain health and cognition easily with these simple tips – News

By admin1
September 15, 2022
458
0
Share:

[ad_1]

The ability to understand and acquire knowledge is protected by a healthy diet, regular exercise, vitamin D consumption, and participation in social activities.

Screenplay: Anne-Marie Stevens, Tereem Khan
Media Contact: Anna Jones

Sameera Davuluri2 60cbc56dbd865a753bfe961fa6639dc0Sameera Davuluri, MD,
Photo: Julie Nicole Miller
According to Alzheimer’s Disease International, dementia begins to affect 10 million people each year, and the number of people with dementia is only increasing. But there are ways to improve brain health and prevent at least some of the complications associated with aging, dementia, and similar conditions.

The Marnix E. Heersink School of Medicine at the University of Alabama at Birmingham wants to help patients learn more about the relationship between brain health and lifestyle. The effort is supported by the Department of Family and Community Health Clinics and the UAB Evelyn F. McKnight Brain Institute.

Sameera Davuluri, M.D., assistant professor and medical director of the Family Medicine Clinic at UAB Hoover Primary Care, offers advice on how to keep your brain healthy.

eat healthy

Diet is an important factor that influences overall health. According to Davuluri, certain foods that are good for your heart are good for your brain.

“There is no single food that is key to brain health, and there is no evidence that eating or avoiding one particular food can prevent cognitive decline,” Davuluri said. But patients need to focus on healthy food combinations throughout their lives to strengthen their minds and bodies.”

Following diets such as the Mediterranean diet, the Diet to Stop Hypertension (DASH), and a combination of the two called the MIND diet can help improve brain health. The MIND diet includes leafy greens and other vegetables, berries, whole grains, fish once a week, chicken twice a week, and beans, nuts, and olive oil as edible fats. Both the Mediterranean and MIND diets allow moderate amounts of wine.

Davuluri suggests watching your alcohol consumption and limiting pastries, processed foods, red meat, full-fat dairy, and salt. She also suggests eating fish, as it is the most powerful factor influencing higher cognitive function and slower decline.

“Diets high in monounsaturated and polyunsaturated fats are beneficial in improving brain health, reducing risk factors for stroke and heart disease,” says Davuluri. “There are no vitamins or supplements that have been shown to prevent cognitive decline. Certain conditions and vitamin deficiencies (B12 and folic acid) that can cause cognitive decline are reversible, so always check with your doctor. Consult: It’s never too late to start eating healthy and making small practical changes that are sustainable.”

For more specific recommendations regarding daily alcohol intake, consult your primary health care provider or visit the 2015-2022 Dietary Guidelines for Americans.

regular exercise

The Centers for Disease Control and Prevention says regular physical activity is an important part of a healthy lifestyle and is good for your brain as well as your muscles and bones.

According to Davuluri, several studies have linked aerobic exercise to cognitive improvements.

“Most adults should get 150 minutes of moderate-intensity exercise per week, which can be broken down in 30 minutes a day, five days a week,” says Davuluri. “This doesn’t have to happen all at once, it can only happen at the gym. Try incorporating activities into your daily routine, like walking the dog or moving your body while watching TV.”

be social

Getting involved in social activities and communities is good for your mental health as well as your brain health.

“Social activity reduces isolation, improves well-being, and improves cognition,” Davuluri said. Challenge yourself intellectually: get enough sleep, live a normal life, and focus on eating healthy.”

take a vitamin d supplement

Vitamin D is a fat-soluble vitamin that is naturally available in certain foods, fortified in other foods, or used as an over-the-counter supplement.

“Vitamin D is primarily responsible for promoting calcium balance in the body and helping to strengthen bones.”It also has other roles, such as reducing inflammation and regulating immune function. We don’t have enough information to find a correlation with brain health.”



[ad_2]

Source link

Tagsbodydailydaydietdogfamilyfoodgoodgymhealthhealthylifelifestylelikeslivelookphotoredsharewine
Previous Article

Beacon Media + Marketing Releases Guide on ...

Next Article

U.S. Secretary of Education promotes access to ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Best Early Labor Day Fashion Sale — Up to 83% Off

    August 23, 2022
    By admin1
  • All

    Digital Marketing: A Growing Career Perspective | Celent

    September 28, 2022
    By admin1
  • All

    SOJERN celebrates 15 years of supporting travel, expands platform capabilities to better serve travel marketers

    September 20, 2022
    By admin1
  • Science & Tech

    Lynchburg University Receives Science Grant, Sends Students to Wyoming

    September 30, 2022
    By admin1
  • Science & Tech

    How DC Comics’ failure changed sci-fi and fantasy forever

    August 20, 2022
    By admin1
  • Science & Tech

    Can science and religion coexist?

    September 16, 2022
    By admin1

You may interested

  • Science & Tech

    Solésence Beauty Science Returns to the Beauty Biz Roundtable

  • Science & Tech

    Science must aim at peace, says Pontifical Academy of Sciences

  • Science & Tech

    Philanthropists donate $172 million to accelerate drug development for next pandemic.chemistry

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Health Notes | News, Sports, Jobs

    By admin1
    September 6, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy