Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys ...

      August 12, 2026
      0
    • Descubre Nueva York junto a otros en las visitas en grupo al ...

      August 11, 2026
      0
    • Au-dessus des lumières de la ville : des expériences inoubliables à l'One ...

      August 8, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

  • Erfrischen Sie sich, tanken Sie neue Energie und meistern Sie Ihren Tag mit dem Faxe Kondi Energy Booster

  • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys with Ferryhopper

Health & Beauty
Home›Health & Beauty›Jessica Pegula surges at US Open after mother’s health issues

Jessica Pegula surges at US Open after mother’s health issues

By admin1
September 4, 2022
388
0
Share:

[ad_1]

Not only is Jessica Pegula one of America’s top tennis players, reaching the Round of 16 at the US Open for the first time, her parents own the Buffalo Bills.

As the Bills prepare to open the NFL season with the Rams on Thursday night, Pegula climbed to new heights in his tennis career, beating Chinese qualifier Yuan Yue 6-2 6 at Arthur on Saturday. -7(6) beaten 6-0. Ash Stadium.

This sets up a quarterfinal match against Petra Kvitova, who defeated Pegula in the third round of the 2020 US Open.

“I think I’m a lot better now than the last time I played her,” said Pegula, 28. how she gathers

Pegula’s parents, Terry and Kim, own the Bills and Buffalo Sabers. Jessica wears a pair of beaded bracelets, one blue and red for Bill and one blue and yellow for Saber. I’m a fan.

It’s been a trying few months for the Pegula family, who announced in mid-June that Kim was receiving treatment for an unspecified health issue.

In a June 14 statement, the family said, “We are so grateful for her progress over the past few days.” Please send your prayers and ask that you respect our need for privacy.”

Two weeks later, the family released another statement saying Kim was “going well” and was “resting and rehabilitating” due to health issues.

Buffalo Bills co-owner Kim Pegula talks with his teammates before the game.

Buffalo Bills co-owner Kim Pegula speaks with colleagues before a game between the Bills and the New York Jets in September 2019.

(Bill Costrone/Associated Press)

Jessica Pegula indicated in a subsequent interview that her mother is recovering.

In May, three weeks before her health issue was announced, Kim Pegula spoke to The Times about what it’s like to develop a world-class tennis player.

“We call her our first sports team,” Pegula’s mother said at an NFL meeting in Atlanta on May 24. “The Sabers and the Bills and all the other teams. It was my first opportunity as a parent to really understand that I wanted to be a professional player because I didn’t know the future of owning a .

“She is 28 now. and I am very satisfied.

“As supportive as our parents were, we took her there, bought her a racket, took her lessons. It’s on her because she put a lot of time into it…and we’re seeing it unfold now.”

These league meetings took place during the French Open, where Pegula, nicknamed Jesse, made it to the quarterfinals. Her parents glanced at her cell phone during meetings to track her matches.

“We keep track of scores and little balls as she serves.” Let me know when you’re done.” He is more point by point. I’m kind of like, OK, end of the first set, end of the match. ”

When did Pegulas realize that his daughter had an extraordinary talent?

Jessica Pegula returned a shot to Yuan Yue in Saturday's third round match.

Jessica Pegula returned a shot to Yuan Yue in Saturday’s third round match.

(Eduardo Munoz Alvarez/Associated Press)

“My husband and I disagree,” she said at the time. “He says he knew from day one, but I was like, ‘Oh, come on. You really didn’t know. So many things happen between 7:00 and he’s 8:00.’

“I think there have been certain matches in her career where you’ve seen that. Now I’m just trying to be consistent. , I’m just saying that you can play with any of these top-ranked women.

Pegula is ranked 8th among female players and the highest among American players. The highest-ranked American male is Taylor Fritz, who is his 12th.

“When she was young and moved to Hilton Head (SC), she wanted to play tennis. You brag about your kids,” Kim Pegula’s mother said in May. “People ask and we say, ‘Oh yeah, she wants to be a pro.'” Everyone thinks you’re just bragging about your kid.

“So now they’re like, ‘Wait… I just saw her on TV. teeth very good. ‘ So for someone who knew us when she was younger, it’s a bit of a gratification. She just had this dream. It’s fun to see it come to life. ”

[ad_2]

Source link

Tagsbluedayfamilyfungoodhealthkidslifememynewnightredsaturdaysportstimetopwomenworldyellow
Previous Article

Mercedes-Benz Prague Fashion Week Highlights-Xinhua News Agency

Next Article

Major Top 10 Teams, Playoff Hopeful Loses ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Technology

    Brighten Your Path: A Comprehensive Review of Yitamotor Headlight Sets

    October 8, 2024
    By admin1
  • Health & Beauty

    2022 U of U Health Research Funds Exceed $450 Million

    September 14, 2022
    By admin1
  • All

    E-Impact Marketing Named 14 Clients to 2022 Inc.’s 5000 Fastest Growing Companies List

    August 17, 2022
    By admin1
  • Export TestHealth & Beauty

    Der ultimative Leitfaden für CBD-Blüten: Die Wellness-Vorteile der Natur erschließen

    October 30, 2024
    By admin1
  • Science & Tech

    we are not ready for volcanoes

    August 19, 2022
    By admin1
  • All

    Brought to you by the FTC: Digital Marketing Events and Blurry Ads for Kids | Baker Hosteller

    October 21, 2022
    By admin1

You may interested

  • Science & Tech

    North Arkansas College receives $747,000 National Science Foundation grant to increase STEM completion

  • Science & Tech

    25 years of putting climate science into action

  • Science & Tech

    Allergy season will be affected by climate change, scientists say

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,752)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

    By techsmillion
    August 19, 2026
  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

    By techsmillion
    August 18, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Are smartwatch health apps smart enough to detect atrial fibrillation? — Science Daily

    By admin1
    October 13, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy