Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Vom Bildschirm zum Bildschirm: Memmo Bringt Promis Direkt Zu Dir

      July 18, 2025
      0
    • Entdecken Sie die Freude am nahtlosen Reisen: Die Kraft von Deutschlandticket entfalten

      July 10, 2025
      0
    • Wählen Sie die beste Fähre für Ihre nächste Reise: Starten Sie in ...

      July 10, 2025
      0
    • The QHotels Collection – Elegant Escapes, Golf Retreats, and Relaxed Luxury Stays ...

      July 9, 2025
      0
    • Erkunden Sie Europas atemberaubendste Städte bequem und entspannt bei Ihrem nächsten Städtetrip

      July 9, 2025
      0
    • Caesars Rewards – The Ultimate Destination for Gaming, Luxury, and World-Class Hospitality

      July 9, 2025
      0
    • Discover Xcaret: Where Nature, Culture, and Adventure Come to Life

      July 9, 2025
      0
    • One World Observatory: Rise Above, See Beyond, Feel New York Like Never ...

      July 9, 2025
      0
    • Unveiling the Post Office: Unlocking a World of Convenience and Services

      July 9, 2025
      0
  • Fashion
    • Erleben Sie den Luxus von Sisley Paris: Premium-Hautpflege und Make-up für ein ...

      July 11, 2025
      0
    • Empowerment Starts Underneath: The EBY Revolution in Comfort and Purpose

      July 9, 2025
      0
    • Shop Ethical Fashion and Vintage Finds to Support Global Causes While Elevating ...

      July 9, 2025
      0
    • Wear the Change – Explore Comfort and Purpose with EBY Intimates

      June 26, 2025
      0
    • Seamless Confidence – Redefining Everyday Comfort with EBY Intimates

      June 20, 2025
      0
    • Stylish Finds for Little Ones: Shop Pre-Loved Kids' Dresses with Purpose

      June 13, 2025
      0
    • Jeden Kilometer meistern: Laufbar Laufjacke für Herren – Unübertroffener Komfort, Stil und ...

      June 10, 2025
      0
    • Scopri profumi femminili di lusso per ogni stato d'animo e occasione

      June 6, 2025
      0
    • Shop Smart, Dress Sharp: Ethical Superstore Men’s Shirts for a Stylish and ...

      June 4, 2025
      0
  • Health & Beauty
    • Erschließen Sie Ihr Potenzial mit Forever Young: Eine Reise zu Gesundheit und ...

      July 12, 2025
      0
    • Choose the Right Fragrance for You: Top Perfumes That Define Femininity and ...

      July 9, 2025
      0
    • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

      June 12, 2025
      0
    • Verwandeln Sie Ihr Haar mit MiiN Cosmetics: Die ultimative Revolution in der ...

      June 11, 2025
      0
    • Verbessern Sie Ihre Wellness-Routine mit Lucky Hemp CBD Ölen

      June 11, 2025
      0
    • L'ARISÉ Beauty: Entdecken Sie den Reiz von pudriger Eleganz und zeitloser Raffinesse ...

      June 9, 2025
      0
    • Scopri i prodotti delicati per la cura dei capelli e per ottenere ...

      June 8, 2025
      0
    • Trasforma la tua pelle con questi prodotti idratanti essenziali – Sconti speciali

      June 6, 2025
      0
    • Le migliori soluzioni per la cura della pelle: protezione solare e sollievo ...

      June 6, 2025
      0
  • Science & Tech
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Vom Bildschirm zum Bildschirm: Memmo Bringt Promis Direkt Zu Dir

  • Experience Baseball More Than Just a Game: Step Up to the Plate with New York Yankees’ Legendary Fan Experience

  • Ultimate New York Yankees Memorabilia: Show Your Team Pride Today!

  • Feel the Pulse of Baseball’s Greatest Stage: Score Big with New York Yankees Tickets for an Unforgettable 2025 Season

  • Erschließen Sie Ihr Potenzial mit Forever Young: Eine Reise zu Gesundheit und Vitalität

  • Erleben Sie den Luxus von Sisley Paris: Premium-Hautpflege und Make-up für ein makelloses Aussehen

  • Drive Smart, Travel Far – Discover Flexible, Eco-Friendly Car Hire with Europcar Worldwide

  • Europcar – Reliable Car Rentals With Flexible Plans and Hidden Fee Risks

Health & Beauty
Home›Health & Beauty›Jessica Pegula surges at US Open after mother’s health issues

Jessica Pegula surges at US Open after mother’s health issues

By admin1
September 4, 2022
258
0
Share:

[ad_1]

Not only is Jessica Pegula one of America’s top tennis players, reaching the Round of 16 at the US Open for the first time, her parents own the Buffalo Bills.

As the Bills prepare to open the NFL season with the Rams on Thursday night, Pegula climbed to new heights in his tennis career, beating Chinese qualifier Yuan Yue 6-2 6 at Arthur on Saturday. -7(6) beaten 6-0. Ash Stadium.

This sets up a quarterfinal match against Petra Kvitova, who defeated Pegula in the third round of the 2020 US Open.

“I think I’m a lot better now than the last time I played her,” said Pegula, 28. how she gathers

Pegula’s parents, Terry and Kim, own the Bills and Buffalo Sabers. Jessica wears a pair of beaded bracelets, one blue and red for Bill and one blue and yellow for Saber. I’m a fan.

It’s been a trying few months for the Pegula family, who announced in mid-June that Kim was receiving treatment for an unspecified health issue.

In a June 14 statement, the family said, “We are so grateful for her progress over the past few days.” Please send your prayers and ask that you respect our need for privacy.”

Two weeks later, the family released another statement saying Kim was “going well” and was “resting and rehabilitating” due to health issues.

Buffalo Bills co-owner Kim Pegula talks with his teammates before the game.

Buffalo Bills co-owner Kim Pegula speaks with colleagues before a game between the Bills and the New York Jets in September 2019.

(Bill Costrone/Associated Press)

Jessica Pegula indicated in a subsequent interview that her mother is recovering.

In May, three weeks before her health issue was announced, Kim Pegula spoke to The Times about what it’s like to develop a world-class tennis player.

“We call her our first sports team,” Pegula’s mother said at an NFL meeting in Atlanta on May 24. “The Sabers and the Bills and all the other teams. It was my first opportunity as a parent to really understand that I wanted to be a professional player because I didn’t know the future of owning a .

“She is 28 now. and I am very satisfied.

“As supportive as our parents were, we took her there, bought her a racket, took her lessons. It’s on her because she put a lot of time into it…and we’re seeing it unfold now.”

These league meetings took place during the French Open, where Pegula, nicknamed Jesse, made it to the quarterfinals. Her parents glanced at her cell phone during meetings to track her matches.

“We keep track of scores and little balls as she serves.” Let me know when you’re done.” He is more point by point. I’m kind of like, OK, end of the first set, end of the match. ”

When did Pegulas realize that his daughter had an extraordinary talent?

Jessica Pegula returned a shot to Yuan Yue in Saturday's third round match.

Jessica Pegula returned a shot to Yuan Yue in Saturday’s third round match.

(Eduardo Munoz Alvarez/Associated Press)

“My husband and I disagree,” she said at the time. “He says he knew from day one, but I was like, ‘Oh, come on. You really didn’t know. So many things happen between 7:00 and he’s 8:00.’

“I think there have been certain matches in her career where you’ve seen that. Now I’m just trying to be consistent. , I’m just saying that you can play with any of these top-ranked women.

Pegula is ranked 8th among female players and the highest among American players. The highest-ranked American male is Taylor Fritz, who is his 12th.

“When she was young and moved to Hilton Head (SC), she wanted to play tennis. You brag about your kids,” Kim Pegula’s mother said in May. “People ask and we say, ‘Oh yeah, she wants to be a pro.'” Everyone thinks you’re just bragging about your kid.

“So now they’re like, ‘Wait… I just saw her on TV. teeth very good. ‘ So for someone who knew us when she was younger, it’s a bit of a gratification. She just had this dream. It’s fun to see it come to life. ”

[ad_2]

Source link

Tagsbluedayfamilyfungoodhealthkidslifememynewnightredsaturdaysportstimetopwomenworldyellow
Previous Article

Mercedes-Benz Prague Fashion Week Highlights-Xinhua News Agency

Next Article

Major Top 10 Teams, Playoff Hopeful Loses ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Fall 2023 Trend Report: Silver Fashion

    September 29, 2023
    By admin1
  • Science & Tech

    Global Life Science Analytics Market Report 2022: Rising Prevalence of Chronic Diseases Key Factors Driving Growth – ResearchAndMarkets.com

    September 6, 2022
    By admin1
  • All

    Kennected CEO Speaks at Web Summit 2022 Amidst Very Positive Testimony

    December 3, 2022
    By admin1
  • Health & Beauty

    State-led mental health reforms have failed before. But 2022 will be different.

    August 30, 2022
    By admin1
  • Science & Tech

    50 million tons of water vapor from Tonga eruption could warm Earth for years

    September 24, 2022
    By admin1
  • Science & Tech

    Defense Business Overview: Lockheed Executives on Global Supply Chains and Europe’s F-35. Lawmakers are backing the L3 Harris-Aerojet deal for ...

    June 26, 2023
    By admin1

You may interested

  • Science & Tech

    Greensboro Science Center to Host Brixboro Oct 1 & 2, 2022 | Kids Family

  • Science & Tech

    Remarks by Vice President Harris to Political Science Students at the University of Wisconsin-Milwaukee

  • Science & Tech

    DWR tunnel vision: ignoring science doesn’t go away

Search

Categories

  • All (1,240)
  • Animal Food (19)
  • Books & Novels (21)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,711)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (16)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (21)
  • Health & Beauty (1,592)
  • Home&Living (218)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (10)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,346)
  • Science & Tech (1)
  • Sports (27)
  • Technology (157)
  • Travel & Lifestyle (1,652)
  • Travel & Lifestyle (14)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Vom Bildschirm zum Bildschirm: Memmo Bringt Promis Direkt Zu Dir

    By admin1
    July 18, 2025
  • Experience Baseball More Than Just a Game: Step Up to the Plate with New York ...

    By admin1
    July 16, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • GroundTruth Appoints Brandon Rhoten as CMO

    By admin1
    September 21, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy