Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Travel & Lifestyle
Home›Travel & Lifestyle›After Abortion Restrictions, Texas Rethinks Sex Education

After Abortion Restrictions, Texas Rethinks Sex Education

By admin1
September 17, 2022
347
0
Share:

[ad_1]

DALLAS — JR Chester got pregnant the summer before her senior year of high school. She graduated after giving birth, and she was pregnant again when she entered college in the fall of that year.

She was a teenage mother, just like her mother, grandmother, and great-grandmother. Her school did not teach sexual health education, and preventing pregnancy was a foreign concept. Her sons are now teenagers.

“If you don’t know your options, you have no options,” said Chester, now Program Director for Healthy Futures at Texas, a nonprofit sexual health advocacy and education organization. And it just felt like: when it happens, it happens.

While teenage pregnancies have declined both statewide and nationally in recent decades, Texas still has 22.4 births per 1,000 girls and women ages 15 to 19. It is one of the states with the highest rate. 6.1 Along with Alabama, Texas has the highest rate of her teen re-pregnancy in the nation. This fall, Texas school districts are marking a shift to what educators call an “abstinence-plus” curriculum. This is the first time the state has revised its standards for sexual health education in over 20 years.

Districts may choose their own curricula and teach more than the state requires, but state minimum health standards currently focus on more than just abstinence to stop pregnancy. It also includes teaching middle school students about birth control pills and providing additional information on preventing sexually transmitted diseases, including humans. Papillomavirus (HPV) associated with several cancers.

Previously, a 2017 report found that 58% of Texas school districts offered “abstinence-only” sexual health education, and only 17% offered more curricula. A quarter of schools did not offer sex education.

Studies show that sex education programs that teach contraception are effective in increasing contraceptive use and delaying sexual activity among young people. Educational programs that focus on abstinence, on the other hand, have not been shown to be particularly effective in curbing sexual activity in teens.

However, whether Texas teens receive sex education depends on whether their parents are enrolled. Parents used to have to “opt out” of the sex education portion of their child’s health classes, but now have to “opt in” for their child to take those lessons. This means that the parent must sign and return the consent form. The change is not due to parental objections, but because of missing forms and language barriers, it can lead to children missing out on a lot.

These changes in sex education came as states phased out access to abortion following a June Supreme Court ruling that overturned Roe v. Wade, which guaranteed the constitutional right to abortion. arose. Texas has one of the most restrictive abortion laws in the country. With many state governments enacting laws banning abortion, the question of how schools educate young people about sexual health and development has taken on new urgency.

Demonstrators march with signs during a rally for abortion rights
Demonstrators march with signs during an abortion rights rally in Austin, Texas, on June 25.Sergio Flores/Getty Images File

Health advocates say many women may have no choice but to continue their pregnancies to full term, creating a new class of haves and have-nots. do not do.

Texas is vast and diverse, requiring educational policies that can accommodate remote frontier towns and sprawling metropolitan areas. Both are areas with high rates of unintended pregnancies in her teens.

In 2019, the Texas Board of Education began rewriting health education standards that have been in place since the 1990s. We maintained the standard that “there is a risk associated with sexual activity and abstinence is the only 100% effective way to avoid the risk”.

According to the Guttmacher Institute, a reproductive health research institute, 39 states and the District of Columbia require information about abstinence to be provided in sex education classes, with 29 classes “emphasizing” abstinence. is needed. Only 20 states and Washington, DC require classes to provide information about contraception.

high teen pregnancy

Under Texas law, sex education must still present abstinence as a “preferred option.” When schools teach condoms and other contraceptive methods, they use what the State of Texas calls “actual human usage,” or “typical usage,” as described in the medical literature. Must provide.

The changes going into effect this year primarily address when and when Texas students learn about specific sexual health issues. Under the state’s previous standards, Texas schools could teach birth control methods beyond abstinence, but only in high school health classes, which were optional. In addition, information about contraceptives is taught in mandatory middle school health classes.

In May, the Dallas Independent School District, one of the largest in the nation, approved course materials to meet new state requirements. But school officials here wanted to do more, given the scope of the problem. Advocates say Dallas County has the highest rate of re-pregnancy among her teens in the country.

The school district’s curriculum exceeds state minimum standards and includes additional information on gender identity and contraceptives, as well as a contract with Texas Healthy Future to teach optional after-school programs for high school students.

School district board member Dustin Marshall said the previous curriculum was “very scientific” and “very dry”, leaving out basic information about contraception such as how to wear a condom.

“One of the main ways to reduce teenage pregnancies and alleviate generational poverty from teenage pregnancies is to teach contraception,” he said. “Don’t assume that if you teach abstinence, all children will comply. From my point of view, it’s a little crazy.”

Some critics say state standards have improved, but fall short on LGBTQ+ issues, including consent and gender identity. A state board mandates that schools teach healthy relationships and set personal boundaries for sexual activity.

Under Texas law, parents have the final say in whether their children receive sexual health education, as well as what those lessons cover.

For nearly 30 years, school districts have been required to establish and appoint school health advisory committees. The School Health Advisory Committee is tasked with reviewing and recommending health curricula, including sexual health. The content of sex education classes varies greatly from district to district, as most members must be guardians rather than district employees.

Jen Biundo, senior director of policy and research at Healthy Futures of Texas, briefed parents and teens who want to teach teens about sex about the research she helped conduct. Although she ranks her parents and her teens differently, she said the schools, doctors and parents’ choices are the same. The health advocate points out that not all parents are able to educate their children about sex, and many of her teens are living in precarious conditions like foster homes.

Biundo says that when teens are asked where they learn about sex, the most common answer is “friends and the internet.”

In fact, some parents, especially those who were teen mothers, may not know about or how to access contraception. “Where should parents get their knowledge from?” said Chester. “Because they went through the same school system that didn’t teach sex education, and suddenly they knew what to teach their kids.”

“We are ending the generational curse of being uneducated,” she said.

KHN (Kaiser Health News) is a national newsroom that produces in-depth journalism on health issues. Along with Policy Analysis and Polling, KHN is one of three major operational programs. KFFMore (Kaiser Family Foundation). KFF is a donated non-profit organization that provides information on health issues to the public.

follow NBC Health upon twitter & Facebook.



[ad_2]

Source link

Tagscrazyeducationfallfamilyfocusfollowfriendsgirlshealthhealthykidsmynewnewspeopleschoolsummertimeviewwomen
Previous Article

Fierce Nevada gubernatorial race brings Republican challenger ...

Next Article

Scrunchie Inventor Dies, Leaving Amazing Fashion Legacy ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    Legislators, Educators Discuss State Testing, Potential Reform of Teaching Styles

    September 7, 2022
    By admin1
  • All

    Merkle SG overcomes rapidly changing marketing landscape

    September 20, 2022
    By admin1
  • Science & Tech

    These Water Worlds Could Exist Outside Our Solar System

    September 9, 2022
    By admin1
  • Travel & Lifestyle

    Berger, Earls Deny Denial Request in Leandro Education Funding Case

    August 20, 2022
    By admin1
  • Science & Tech

    Fairfax County Board of Education criticized for ’embarrassing’ ‘anti-science’ memo on masking

    August 17, 2022
    By admin1
  • Fashion

    Alo Yoga plans first presentation at New York Fashion Week – WWD

    August 26, 2022
    By admin1

You may interested

  • Science & Tech

    College of St. Benedict Adds Data Science Major to St. John’s

  • Science & Tech

    Cree youth want to inspire others with science

  • Science & Tech

    The Kentucky Science Center announces the name of the newly installed World’s Fair Triceratops.news

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Spacewalk, Dragon Ops, Health Research Coming Soon – Space Station

    By admin1
    August 15, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy