Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›Furman University graduate David Trone donates to support mental health

Furman University graduate David Trone donates to support mental health

By admin1
August 16, 2022
447
0
Share:

[ad_1]

Furman University announced on Tuesday, August 16, that Rep. David Trone has donated $10 million to the university.

Among the many concerns about the side effects of the COVID-19 pandemic is a quietly escalating crisis among children and young people: the rising incidence of mental illness.

But a new donation to Furman University allows the school to meet this challenge head-on, helping students build the emotional resilience they need to navigate an increasingly complex world. increase.

On Tuesday, Furman announced that Rep. David Torrone has donated $10 million to the university. Many of them will fund the expansion of mental and emotional health programs on campus.

“In this day and age, it is imperative that we work together to break down the stigma surrounding mental health, ensure tolerance in diverse communities, and provide students with the tools and resources to succeed,” said David. and June Trone Family Foundation.

A 1977 graduate of the same university and a Democrat in Maryland, Trone is also the founder and co-owner of retail chain Total Wine and More. A long-time advocate for mental health initiatives in Congress, he is the founder and co-chair of the bipartisan Addiction and Mental Health Task Force and co-chair of the US Commission on Combating the Trafficking of Synthetic Opioids.

Trone’s family has struggled with addiction and mental illness for generations. He said his 2016 run to the presidency was in part prompted by his beloved nephew’s battle with substance abuse. His nephew Ian Tron later died of a fentanyl overdose.

Mount Mitchell Eco Retreat:Experience the health and healing powers of the outdoors

who makes what:Here’s what Greenville County Schools employees create

David Torrone’s donation will allow the university to take mental health services to the “next level,” said Elizabeth Davis, president of Furman University.

“I am excited to help students learn how to be mentally healthy, just as we want them to be physically and academically healthy,” she said. “It creates a really fulfilling student experience.”

Of Trone’s $10 million donation, $8.5 million will support mental health services.

$1 million will be used to renovate the Furman Counseling Center, expand space for group therapy, mindfulness practices and other programs. The renovations are expected to be completed later this year, he said.

The remaining $7.5 million will create the Trone Family Fund for Student Mental Health and Wellbeing and maintain a diverse healthcare provider staff that can adapt as care methods evolve.

The funding will also allow Furman to develop an expanded mental health program. Services include peer mentoring, body image and eating disorder programs, student-athlete screening, alcohol and drug prevention, sexual health, stress management skills, and suicide prevention training.

Davis calls the school’s strategy on mental health “proactive, not reactive,” and describes a “scaffolding approach” that equips students with key skills to maintain their mental and emotional health. .

Key to that strategy, Davis said, is the “most innovative” part of Furman’s initiative: an “integrated approach” to mental and emotional health.

“[Students’]academic performance affects their mental health, and mental health affects their academic performance,” she said. “She works with all departments on campus to figure out how to address different challenges in a cohesive and collaborative way, rather than a one-off, as if one does not affect the other. I need a partner.”

Connie Carson, Furman’s vice president of student life, agreed with this approach.

“We want to communicate openly about the importance of well-being as a foundation for student success in and out of the classroom,” she said.

Davis added that the gift will support professional training for faculty in identifying students at risk, enabling timely intervention and support.

Furman, she observed, is particularly well-equipped to implement this integrated strategy because the university already fosters a culture of collaboration across its campus.

As for when students will realize the benefits of Trone’s gift, “soon,” Davis said. The university has already hired a health and welfare coordinator who assumed a new role earlier this month.

But Trone’s gift is not just dedicated to mental health services. Of his $10 million donation, the remaining $1.5 million will be used to create the Hillel Endowment Fund to foster “a stronger Jewish life for all students and the wider community.” The university then said in a press release.

“We have a strong religious life group, but we really need more resources and rabbinic time for our Jewish students,” Davis said.

Davis pointed out that spirituality is often an integral part of student well-being. In that regard, initiatives funded by Trone donations, the Hillel Endowment Fund and the Trone Family Fund for Student Mental Health, support student health.

According to Davis, Furman’s students will benefit from Thorone’s gift, not just now, but “for generations to come.”

[ad_2]

Source link

Tagsbodydayfamilygifthealinghealthhealthylifenewpeoplerunschoolstrongsuccessthetimetrainingwineworkworld
Previous Article

Gen Z is still shopping at fast ...

Next Article

Survey: Rating Action: Moody’s Confirmed by Aa2 ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    4 Ways Edtech Entrepreneurs Can Earn Trust and Unlock New Opportunities With Education Customers

    October 23, 2023
    By admin1
  • Science & Tech

    Financial Freedom: Transforming Business with Online Accounting

    January 25, 2024
    By admin1
  • Travel & Lifestyle

    The pandemic has boosted private education, but will security do the same?

    September 15, 2022
    By admin1
  • All

    Groundbreaking -50% Offer for DMI’s In-Class Professional Diploma in Digital Marketing | Stockwatch

    August 12, 2022
    By admin1
  • Fashion

    New Mirror House exhibit focuses on fashion history, local women

    August 21, 2022
    By admin1
  • All

    Digital Marketing Guide for Geospatial Technology Companies

    September 8, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    US Pacific allies want more joint exercises and scarce ammunition

  • Science & Tech

    Power Up Your Life: BLUETTI’s Expansion Batteries Overview

  • Science & Tech

    Exploring marine science

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • This former SFCC computer science professor worked on the Ranger and Surveyor lunar exploration missions.

    By admin1
    August 27, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy