Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Unlock the Freedom to Explore New Cities at Your Own Pace with ...

      May 22, 2025
      0
    • TUI Cars - Zuverlässige globale Autovermietung für flexibles Reisen mit allem Drum ...

      May 22, 2025
      0
    • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

      May 18, 2025
      0
    • Travel in Style and Comfort with Europcar’s Wide Range of Premium Vehicles

      May 18, 2025
      0
    • From Business Trips to Scenic Escapes – Europcar Delivers Every Time

      May 18, 2025
      0
    • Experience Seamless Mobility Across Continents with Europcar’s Global Fleet

      May 18, 2025
      0
    • Unlock Limitless Travel Possibilities with Europcar’s Flexible Rental Solutions

      May 18, 2025
      0
    • Unwind in Style: Discover the Luxury and Charm of the QHotels Collection ...

      May 15, 2025
      0
    • Experience The Heart Of The City Through Cutting-Edge Interactive Technology

      May 15, 2025
      0
  • Fashion
    • L'ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

      May 18, 2025
      0
    • Erhöhen Sie Ihr Schuhspiel: Herren-Barfußstiefel von Groundies

      May 15, 2025
      0
    • Treten Sie ein in die Welt minimalistischer Barfußschuhe für ultimative Freiheit und ...

      May 15, 2025
      0
    • Luis Trenker Kleider: Entworfen für Frauen, die sich trauen, aufzufallen

      May 14, 2025
      0
    • Laufen bei jedem Wetter: Entdecken Sie die besten Laufjacken bei Laufbar

      May 14, 2025
      0
    • Laufen mit Komfort und Stil: Entdecken Sie die besten Laufschuhe bei Laufbar

      May 14, 2025
      0
    • Améliorez votre condition physique avec Myprotein : Les meilleures ventes de vêtements ...

      May 10, 2025
      0
    • Elevate Your Wardrobe with Fruugo: A Vast Selection of Women’s Shoes for ...

      May 8, 2025
      0
    • Enhance Your Golf Game and Style with Premium Men’s Headwear from Discount ...

      May 5, 2025
      0
  • Health & Beauty
    • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana - Bottega Verde: Bellezza naturale ...

      May 22, 2025
      0
    • L'ARISÉ Damenduftkollektion: Eleganz in jeder Note

      May 19, 2025
      0
    • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

      May 19, 2025
      0
    • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

      May 19, 2025
      0
    • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

      May 18, 2025
      0
    • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

      May 18, 2025
      0
    • Fitness Trifft Innovation: Die Speediance Revolution Beginnt Jetzt

      May 15, 2025
      0
    • Erleben Sie die Kraft natürlicher Inhaltsstoffe in den MiiN-Körpercremes

      May 15, 2025
      0
    • Vom Bauernhof zur Verpackung: Das Engagement von Lucky Hemp für hochwertige CBD-Blüten

      May 15, 2025
      0
  • Science & Tech
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
    • Revolution beim Kochen im Freien: Rüsten Sie sich mit Ration1.de Essentials

      December 23, 2024
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana – Bottega Verde: Bellezza naturale dalla Toscana

  • Unlock the Freedom to Explore New Cities at Your Own Pace with Convenient Vehicle Rentals

  • NINJA Küche Deutschland: Intelligente Geräte, die den Kochalltag verändern

  • TUI Cars – Zuverlässige globale Autovermietung für flexibles Reisen mit allem Drum und Dran

  • Die besten Porzellan-Geschirrkollektionen für alle, die Wert auf Design und Alltagstauglichkeit legen

  • Egret Elektro-Roller und Zubehör: Erhöhen Sie Ihre Fahrt mit Innovation und Stil

  • My Egret – Intelligente Mobilität mit Stil und Präzision neu definiert

  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

Science & Tech
Home›Science & Tech›Feminist science is not a contradiction

Feminist science is not a contradiction

By admin1
September 15, 2022
291
0
Share:

[ad_1]

Meearly days During the Covid-19 pandemic, a mystery spread in the news headlines. Men appeared to die from infections at twice her rate as women. To explain this startling disparity, researchers looked at inherent biological differences between the sexes, such as protective levels of sex hormones and distinct immune responses in males and females. Some even went so far as to test the feasibility of treating infected men with estrogen injections.

As a group of researchers affiliated with Harvard University noted earlier this year, this focus on biological sex differences has turned out to be woefully inadequate. By doing so, we can more fully explain the gender gap by social factors such as mask wearing and distancing behavior (less common in men) and testing rates (higher in pregnant women and women). was shown to be health care workers, most of whom were women).

Researchers have uncovered a long-standing trend in medicine to attribute differences in health outcomes to biological rather than social factors. In fact, for reasons unrelated to immunity and hormones, men had higher mortality long before the pandemic. It was important to consider how we interact with inequality.

The 2022 paper is just one example of how feminist intervention can turn bad science on its course and advance the field from epidemiology to evolutionary biology. It was written by members of the Gender Sci Lab, a multidisciplinary research institute that embraces feminist science. This research aims to identify and explore common assumptions about sex and gender that many people, including scientists, make unconsciously.

But most people who came across these findings probably didn’t know that feminism played a role in the research. In his three-year report in his 2022 book Vagina Obscura: An Anatomical Voyage, he explores how the majority of researchers view feminist science and how feminist scientists have to deal with the tools they have to offer. I encountered a deep chasm in between.

As a group of researchers affiliated with Harvard University pointed out earlier this year, this focus on biological sex differences has turned out to be woefully inadequate.

It’s not hard to see why. Among mainstream scientists, the term feminist has often been viewed with contempt, hostility, and an implicit belief that feminist ideals are incompatible with true science. The latter, objective authority.

In practice, feminist science provides powerful tools for examining the histories, contexts, and power structures that question scientific questions. Bringing marginalized perspectives to the table can generate new questions and methodologies that help scientists identify and correct hidden biases. Think of it like a stake fixed to a growing tree. This provides a foothold to help the tree return to its original trajectory when it leans too far to one side.

“Feminist science in the field doesn’t look any different than any other science,” says Heather Shattuck-Heidorn, an evolutionary biologist and co-founder of the GenderSci Lab. people). She says, “There are hypotheses that are supported and hypotheses that are not supported, and you run the analysis, test things, operationalize the variables.”

The difference lies upstream, who takes center stage and which questions are weighted. The more scientists understand this, the better science we can make for everyone.

get the newsletter

Send weekly

Unfortunately, this misconception is deep-seated. Just ask evolutionary biologist Patricia Gowerty, who was radicalized by the feminist movement of the 1960s and her 1970s and was one of the first researchers to earn the title of feminist scientist. In 2012, Gowaty conducted a series of careful replication experiments with Drosophila that challenged the long-held ‘Bateman principle’ of sexual selection.

Her findings help show that this principle that men tend to be more promiscuous than women because of the asymmetry between sperm and eggs is only a hypothesis and is flawed. However, outside of the Gender Studies Department, Gowati’s work is not widely taught. On the other hand, in hallowed halls like Oxford, Bateman’s principle is still canon.

Part of the reason, author Lucy Cook writes in her recent book, Bitch: On The Female of the Species, is that Gowati has effectively been branded as an ideologically driven feminist. increase. “The F-word has a polarizing effect that can undermine solid science,” writes Cook. Even the scientists I interviewed for the book used these tools. Feminists in their work.

But does it really matter? As long as science is perfect, who cares what we call it?

What we lose when feminism is minimized is an understanding of how science actually works.

I would argue that it is important. What we lose when feminism is minimized is an understanding of how science actually works. (and should be objective) perpetuates the outdated idea. When a scientist walks into a lab, they somehow get rid of the values, quirks, and preconceptions that plague us humans. In practice, objectivity, whether racial science is used to support eugenics policies or pro-life lawyers curating research to prove that life begins at conception has long served as a cover for political purposes.

Ironically, sticking to the model that science is objective makes science less objective, less susceptible to criticism, and easier to redirect for nefarious purposes. . Getting the scientific tree straight means first acknowledging that researchers never, in the words of the philosopher Thomas Nagel, “act on what they see out of nowhere.” Scientists, like feminists, have agendas and values, blind spots and biases, just like all of us. Each of us sees through our own limited lens.

By putting the lens back on scientists themselves, feminist scientists are able to see these hidden biases and rectify them. The co-authors pointed to a long history of science using biology to explain perceived gender and racial differences, a history steeped in Western imperialism and eugenics. This made the GenderSci Lab skeptical of purely biological explanations and began investigating other hypotheses.

This isn’t the first time feminist science has corrected wrong science. For decades, scientists have described sperm as the active agent that seeks out and penetrates passive eggs. Feminist anthropologist Emily Martin pointed to the sexist trope underlying this story, prompting researchers to discover an equally active element within women’s bodies…the preparation in the first place.

Similarly, sexual development in the womb has long been described as proceeding along one of two pathways in the segment of the so-called masculinity-encoding Y chromosome that signifies the development of the testis and penis. . Or, as one textbook from 2017 put it, its lack led to ovarian and clitoris development “by default.”In this view, the woman was like the factory settings for her iPhone. but the men had a version with bells and whistles.

Both ideas were based on the premise that the female body is more passive, simpler, and the default setting for the body. As these assumptions came to light, it became clear that female development had not been subjected to the same scrutiny as male development. , spurring the discovery of a genetic component that suppresses the male pathway and leads to ovarian development.

Scientists, like feminists, have agendas and values, blind spots and biases, just like all of us. Each of us sees through our own limited lens.

But biology students usually don’t learn the origins of this new knowledge. The feminist scientist’s name does not appear in most academic footnotes or citations. Instead, students learn that science is self-correcting – even if the correction in this case comes from outside the established. This means that the insights that feminist scientists bring to their field may become part of mainstream knowledge, but there is no trace of how they came about.

Clearly, science’s larger power structures need to update their understanding of how feminist science can help expand human knowledge and take credit for the ways it already has. Until then, there is one thing that scientists who deliberately address these prejudices can do. Erasing the term will only continue the cycle of dismissal and marginalization of feminist scientists and their key contributions to the field.

What about terms like feminist science that make some scientists uncomfortable? The seemingly out of nowhere model begins to fall apart when we admit that we can and indeed must balance looking hard and having deep convictions. It’s time for science to look at the possibilities and stop fearing the F-word. Only then can we widen our lens and begin to improve science for everyone.


Rachel E. Gross is a science journalist and author of Vagina Obscura: An Anatomical Voyage.



[ad_2]

Source link

Tagsbodycanonexplorefallhealthhistorylifelightlookmodelnewnewsperfecttimetreetrendviewwomanwomenwork
Previous Article

Compassion and medical fashion

Next Article

Oakland Tech Alumni Giving Back to Community ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    UArizona Joins University Social Science Foundation

    September 12, 2022
    By admin1
  • Health & Beauty

    FSIS issues public health warning on certain ground beef in HelloFresh meal kits due to potential E. coli O157:H7 contamination

    September 11, 2022
    By admin1
  • Health & Beauty

    Erlebe Die Kraft Der Natur Mit CBD Blume: CBD Blüten Für Deine Ganzheitliche Entspannung

    November 12, 2024
    By admin1
  • Science & Tech

    Rush’s short rope as the starting QB?

    September 15, 2022
    By admin1
  • Travel & Lifestyle

    Opinion: LePage’s hateful plot to undermine public education in Maine

    August 24, 2022
    By admin1
  • Fashion

    SwatchOn unveils the digital twin 3D fabric library building the future of fashion.

    August 17, 2022
    By admin1

You may interested

  • Science & Tech

    Scientists think they’ve solved the ‘mystery’ of how air pollution causes lung cancer : ScienceAlert

  • Science & Tech

    Hampton Roads schools gain accreditation, but data shows science remains a problematic area – The Virginian-Pilot

  • Science & Tech

    5 Illinois CS Students Nominated for 2023 Siebel Scholars Class | Computer Science

Search

Categories

  • All (1,238)
  • Animal Food (17)
  • Books & Novels (14)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (6)
  • Export Test (21)
  • Fashion (1,690)
  • Fitness & Health (17)
  • Food & Drinks (15)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,576)
  • Health & Beauty (20)
  • Home&Living (208)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (4)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,344)
  • Sports (21)
  • Technology (151)
  • Travel & Lifestyle (5)
  • Travel & Lifestyle (1,613)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana – Bottega Verde: Bellezza naturale dalla Toscana

    By admin1
    May 22, 2025
  • Unlock the Freedom to Explore New Cities at Your Own Pace with Convenient Vehicle Rentals

    By admin1
    May 22, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • OnlyCurls Brings Natural Beauty and Definition to Every Curl with Their Specialized Hair Care Range

    By admin1
    April 9, 2025

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy