Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Enrichissez votre expérience de lecture grâce à ces grands magazines français

      May 20, 2026
      0
    • Beyond the Clouds: Why This is NYC’s Most Immersive Experience

      May 14, 2026
      0
    • Entdecken Sie die besten Fantasy-Hörbücher für Kinder – voller Staunen und Hoffnung

      May 14, 2026
      0
    • Solve, Move, Win: The Nostalgic Thrill of the Classic Board

      May 14, 2026
      0
    • Beyond the Skyline: Discovering Boston’s Soul from 750 Feet

      May 14, 2026
      0
    • Découvrez le pouvoir du son à travers ces cinq récits à ne ...

      May 14, 2026
      0
    • Scopri i piani sanitari Premium per famiglie per la massima tranquillità a ...

      May 14, 2026
      0
    • Affordable Travel Protection Quotes for Your Next Global Vacation

      May 14, 2026
      0
    • Entdecken Sie preisgekrönte Kunsthotels und Boutique-Unterkünfte in Norwegen

      May 14, 2026
      0
  • Fashion
    • Rinnova il tuo guardaroba quotidiano con questi splendidi abiti midi di Pull&Bear

      May 14, 2026
      0
    • Capo essenziale dalla vestibilità squadrata e di qualità eccellente per una moda ...

      May 14, 2026
      0
    • Scopri la nuova collezione stagionale di top in cotone firmati

      May 14, 2026
      0
    • Premium Oversized Streetwear Shirts Featuring Bold High Definition Prints

      May 14, 2026
      0
    • Απαραίτητες μοντέρνες τσάντες ώμου για μια τέλεια κομψή καλοκαιρινή εμφάνιση

      May 14, 2026
      0
    • CREPSLOCKER: Your Ultimate Destination for Exclusive Sneakers and Streetwear

      May 1, 2026
      0
    • La guida dell'uomo moderno per padroneggiare il look casual perfetto

      April 28, 2026
      0
    • I cinque look in denim indispensabili per ogni guardaroba in questa stagione

      April 24, 2026
      0
    • Best Lightweight Football Shirts from Spain’s Most Passionate Clubs

      April 23, 2026
      0
  • Health & Beauty
    • Capsule di glicinato di magnesio puro per alleviare lo stress e garantire ...

      May 14, 2026
      0
    • Modern Hygiene Made Simple with Wype

      May 12, 2026
      0
    • GETKONG: Naadloze digitale gezondheidszorg binnen handbereik

      May 6, 2026
      0
    • GETKONG: Directe gezondheidszorg, overal en altijd

      May 6, 2026
      0
    • GETKONG: Geef je levensstijl een nieuwe impuls met mode en innovatie

      May 6, 2026
      0
    • GETKONG: Jouw weg naar welzijn, prestaties en een gezonder leven

      May 6, 2026
      0
    • Wype: Smarter Hygiene Solutions for a Cleaner and Easier Lifestyle

      April 23, 2026
      0
    • PetenKoiratarvike: Premium-Lemmikkiruokaa ja Hoitoa Jokaiselle Karvaiselle Ystävälle

      October 9, 2025
      0
    • Transform Your Skin with Dermstore’s Premium Vitamin C Serums

      September 18, 2025
      0
  • Science & Tech
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Enrichissez votre expérience de lecture grâce à ces grands magazines français

  • Scopri mobili belli e resistenti per ogni spazio esterno

  • Znajdź idealne opony do swojego samochodu w iParts

  • Everything You Need to Know About Specialized Travel Insurance Plans

  • Transforma tu cocina casera con estos hornos profesionales Balay

  • Ottimizza i tuoi costi energetici con le nuove soluzioni energetiche di E.ON

  • Najlepsze naturalne przekąski poprawiające codzienne samopoczucie Twojego psa

  • Inside the World of Espionage: The SPYSCAPE Experience

Travel & Lifestyle
Home›Travel & Lifestyle›Delicious, Easy-to-Cook Recipes with Gousto: Your New Meal Inspiration

Delicious, Easy-to-Cook Recipes with Gousto: Your New Meal Inspiration

By admin1
December 8, 2024
236
0
Share:

If you are willing to change meal plans and find something more diverse and colourful then Gousto delivers recipes for tasty meals. Gousto delivers all the ingredients and then it’s up to the cook to plate up meals such as Japanese Katsu Curry or Mongolian-Style Lamb Stir-Fry. Every dish and recipe is served to make cooking as enjoyable as its consumption. Also, along with this, for the first two months on the platform for Gousto, we offer a 50% discount on the first meal, and further, 20% on the following meals.

Chicken Katsu Curry With Pickled Ginger Salad: A Japanese Classic Reimagined

Treat yourself to the classic comfort food nestled beautifully in Gousto Chicken Katsu Curry style. Juicy chicken breast is coated in soft panko breadcrumbs and deep-fried to golden crust and served with a fruity and spicy katsu sauce. Sticky rice comes side by side with a semi-sweet and spicy vinaigrette pickled ginger salad. You can bet your taste buds will be taken for a ride to Japan with this dish.

Crispy, golden chicken
Generously smeared katsu sauce and soft tender rice
Zesty ginger dressing to add life to salad december 2009

Let’s go for some food trail! Sign up with Gousto now and taste this Japanese inspired dish at a two for the price of one! It is your lucky day!

One-Pot BBQ Pork With Smoky Potatoes And Slaw: Flavor in Every Bite

Forget your barbecue grill – this one pot wonder from Gousto delivers all the smoky, savoury flavour without any of the bother. The pork loins are cooked on high heat then covered in a semi thick BBQ sauce to give it that tender feel and smoked garlicky potatoes as well as creamy slaw to complement the dish. Both a weeknight meal or weekend brunch meal will be perfect for this hearty meal.

Delicious tender roasted pork with BBQ sauce on it
These Smoked Paprika Potatoes are flavored with garlic and are easy to make.
Slaw for a nice crusty touch The creaminess of sweet potato makes this dish complete with texture.

Want the simplicity of using a BBQ without any frills? Don’t miss it, you can order with Gousto at the moment and get 50 percent of your first meal!

Chicken Teriyaki With Rice And Peas: A Sweet and Savory Delight

Teriyaki rich juicy chicken here in Gousto , homemade teriyaki glaze is perfect balance of sweet and savory flavours. Accompanied with sides such as fluffy rice and peas, makes for a fulfilling and fulfilling but more importantly a healthy meal. It has under 600 calories as well as a collection of high protein meals making it perfect for a healthy dinner.

This recipe will teach you how to make your own homemade teriyaki sauce which is sticky – sweet.
White rice and sweet peas in delicious combination to ensure the body gets both carbohydrates and vitamins.
Less than 600 calories, lots of protein

Dreaming about a delicious good and healthy meal? Sign up for Gousto right now and collect 50% on your first meal of Chicken Teriyaki!

Fragrant Thai Red Chicken Curry: Spice Up Your Night

You can be ready for a treat with the aromatic taste of the Thai spices used in this chicken curry recipe at Gousto. Delicate chicken and crunchy mangetout are stewed in a rich coconut sauce which taste very vivid. Golden fried onions added on top give this dish the desired crunchy feel.

Soft, tender chicken and crunchy mangetout
Hearty curry and coconut milk enriched sauce
Onions to be fried and added crispy to give the dish some crunch.

This is for individuals who wish to have an insight to the tastes of Thai food. Order Gousto Now and get half price off your first delivery of this tasty curry !

Mongolian-Style Lamb Stir-Fry With Garlic Rice: A Taste of Asia in Every Bite

Take your flavor palates to Northern China with this Mongolian style lamb stir fry recipe with Gousto. The juicy tendered lamb mince is cooked with sautéed onion, carrot and a medley of Hoisin – five-spice – chili sauce. Paired with buttery garlic rice, it takes all the tastebuds to a different level.

Aromatic lamb following hoisin sauce, five-spice and chili
To have contrast in tastes buttery garlic rice is added
Bold, spicy, and delicious

Feeling a stir-fry Asian type dish? To learn more about the food and enjoy another dish that I tried, follow the link and use the promo code to get 50% off on your first order at Gousto.

Start Cooking with Gousto Today!

Thus, replacing the myth of Gousto meal kits being convenient single solutions, are the facts that show Gousto product is exciting and varied. Whether it is Chicken Katsu Curry, the feel-good, comforting dish that tastes exactly how you want comfort food to taste, or Mongolian style Lamb Stir-Fry that challenges your palate, every dish is planned to provoke and tantalise. Now is the perfect time to do so, because if you sign up you get up to 50% off your first meal delivery and 20% off for your first two months.

The best way to forget about your tedious meal plan is here; Join Gousto today!

Tagsbestdaydeliciousdinnerfollowfoodgoodhealthyhomemadeinspirationjapanlifenewnicenightredstylesweetweekendwhite
Previous Article

Brighten Your Smile with Up to 50% ...

Next Article

Transform Your Home into a Winter Wonderland ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    New program to teach addiction science

    September 14, 2022
    By admin1
  • All

    Highwire Public Relations Secures Strategic Investment from Shamrock Capital to Expand Capabilities and Accelerate Growth

    September 15, 2022
    By admin1
  • Travel & Lifestyle

    How to Help Students Avoid Getting Duped Online — and by AI Chatbots

    October 10, 2023
    By admin1
  • Travel & Lifestyle

    The Power of Positive Thinking: Essential Audiobooks for a Better Life

    January 10, 2025
    By admin1
  • All

    6 ineffective digital marketing tactics to avoid

    August 13, 2022
    By admin1
  • All

    Marketing agency Naperville Karben Marketing Karben focuses on creative and digital marketing services on its website

    September 17, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    European Science Park Group Creates Dedicated Space

  • Science & Tech

    Prince Charles is an ardent supporter of pseudoscience

  • Science & Tech

    Northern Kentucky University is the first US to accredit its data science program

Search

Categories

  • All (1,241)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,733)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (17)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,602)
  • Health & Beauty (22)
  • Home&Living (227)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,344)
  • Science & Tech (1)
  • Sports (30)
  • Technology (172)
  • Travel & Lifestyle (1,691)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Enrichissez votre expérience de lecture grâce à ces grands magazines français

    By techsmillion
    May 20, 2026
  • Scopri mobili belli e resistenti per ogni spazio esterno

    By techsmillion
    May 20, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Thompson Health Hosts Nursing Wellness Event Lifestyle

    By admin1
    September 17, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy