Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›At Manifesta, a different healthcare system is more than just a vision: Peoples Dispatch

At Manifesta, a different healthcare system is more than just a vision: Peoples Dispatch

By admin1
September 24, 2022
402
0
Share:

[ad_1]

MPLP staff, patients and volunteers at the Manifesta Health Square. Photo: MPLP

Hundreds of patients from 11 medical centers (MPLP) from all over Belgium joined nurses, receptionists, doctors and other workers in the Health Square (Carre Sante) Manifista – Solidarity festival held on 17-18 September. Volunteers, patients and healthcare workers have come together to face the threat of severe weather and consider what the next few months have in store.

Along with organizations like Viva Salud working to protect the right to health abroad, Medics for the People sees the Manifesta as a place to strengthen ties with the groups they work with on a daily basis. One of many groups. Find new allies to help you achieve your vision. Discussions coordinated by MPLP at the festival build on the new vision statement the organization launched in May of this year.

Beginning with an exchange of views on working conditions and accessibility to primary health care for general practitioners (GPs), Hanne Bosselaers explores the intersection of poor planning in the field of health care workers, primarily administrative tasks and the ongoing elite of medical training. Transformation has led to dark scenarios for all involved.

Medical student Yazdan Najimi and general practitioner Lawrence De Bock provided insights based on what they observe on the ground every day. Constant quotas and stringent admission requirements create obstacles for those wanting to begin training, Najimi cautioned against limiting the number of new doctors entering the health system, despite shortages. This effect was particularly felt by potential physicians from working-class backgrounds, reaffirming the fact that physicians’ class backgrounds make them unaware of many of the everyday struggles that affect their health.

General practitioners tend to be seen as gatekeepers or medical “transformers” who only transfer patients to specialists. Addressing issues beyond training is essential to returning patients to the role of companions guiding them through different stages of life. Due to the general shortage of doctors, young general practitioners often find themselves alone, often lacking guidance and guidance when they start their careers. For example, they are expected to undertake medical security duties independently in remote areas, but may not have the confidence to do so. They often lead to discouragement.

And there is an ever-present administrative burden in the practice of most primary care workers, taking up valuable time that could otherwise be used to get to know their patients better.

Worker Health Left Behind by Employer Preferential Policies

At a time when the commercialization of health makes it increasingly difficult for people to access medical care and makes widespread health problems completely invisible, the importance of caring and well-trained health care workers is underscored. There is no such thing as too much. This is the case for diseases experienced by workers whose health deteriorates due to destabilization, poor working conditions and pressure from employers. If this happens, organizational support will not be available. That means many workers will lose their jobs and have no chance of finding new ones.

MPLP President Janneke Ronse introduces discussion on worker health at Manifesta

In a panel moderated by Elise Derroitte of the Mutualités Chrétiennes (Christian Mutual Health Insurance Fund), Manifesta participants called for measures to protect workers’ health and ensure that responsibility for work-related illnesses is shifted to employers. We shared our thoughts on what we can do to help. Catherine Massy, ​​head of the Belgian Labor Confederation and former worker at the cleaning service company Laurenti, and doctor Elisa Muñoz Gómez (MPLP), have been diagnosed with musculoskeletal disorders such as tendonitis and pinched nerves. talked about the prevalence among workers in back and joints.

Panelists noted that one of the underlying cases of such illnesses is that many workers have precarious jobs and are unable to take sick leave until they are physically unable to bear the pain. This is due to the widespread fear of losing their jobs. This trend is widespread not only in Belgium, but also in the Netherlands, as reported by trade unionist Kitty Jong of the Dutch Trade Union Federation (FNV), and in Eastern European countries, illustrated by examples collected by the People’s Health Movement Europe. increase.

Over time, unaddressed health issues accumulate, leading to an explosion of extended medical leave, serious workplace accidents, and mental health issues. In Belgium, his half a million workers, including those over the age of 55, are now on extended medical leave. According to Elisa Munoz Gomez, this indicates that current practice makes it impossible to work beyond this age, even though many European countries have raised the retirement age above her 65. should be considered

Unless governments put in place mechanisms and policies to protect workers, what will happen in the intervening decade is an overwhelming plunge into poverty and disease exacerbated by the lack of access to medicine.

Building public health and pharmaceutical infrastructure

The actions of pharmaceutical companies during the COVID-19 pandemic were another example of big pharma’s indifference to anything but their own interests. This is clearly not the last pandemic, and treatments for many diseases remain poorly researched as they are deemed unprofitable by their producers. In this context, Medics for the People included an initiative to build a European network for public research and development. Tim Joy (MPLP) presented the idea of ​​a network of Salk Institutes in a discussion of alternatives to official medicines, and researchers and advocates Els Torelle and Ward Rommel called “Cancer I joined from the “Stand up against” initiative.

Tim Joy, Ellen de Meyer, Ward Rommel, Manifesta at a panel discussion on Access to Medicines

Above all, putting the research, production and distribution of medicines in public hands means that many people whose families cannot afford existing treatments because of the very high prices set by the producers will end up needing them. It means making medicines accessible. It’s something that leaves an indelible mark on those who experience it.Panel speakers.

De Meyer is the mother of a daughter whose muscular disease cost nearly €2 million to treat. The family would not have been able to afford it had it been left to the whim of the pharmaceutical companies. They could only manage thanks to solidarity campaigns. The idea kept De Meyer involved as an advocate for another pharmaceutical system.

The founding of the Salk Institute is part of a joint vision of activists such as De Meyer, healthcare workers and patients, along with the fight for better workplaces in the health sector and elsewhere. A discussion organized by the Medic for the people’s discussion indicated that the journey had already begun.

The People’s Health Dispatch is a bi-weekly bulletin published by the United States. national health movement And People’s Dispatch. Click for more articles and to subscribe to People’s Health Dispatch. here.

[ad_2]

Source link

Tagsdailydayeuropefacefamilyfestivalhealthkittylifenewpeoplephotosaludthetimetrainingtransformationtrendworkyou
Previous Article

Science Links of the Week » Explorersweb

Next Article

Are facts always true?A philosopher explains how ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • All

    Why Samsung and ‘The Tonight Show’ Made a Fortnite Game

    September 19, 2022
    By admin1
  • Travel & Lifestyle

    Student loan borrowers want refunds for payments made during suspension

    September 3, 2022
    By admin1
  • All

    Best Digital Marketing Agency in Bangalore

    August 22, 2022
    By admin1
  • Fashion

    Stephen Cook SS23 London Fashion Week Runway Show

    September 18, 2022
    By admin1
  • All

    15 Top Digital Marketing Tools and Why We Love Them

    April 7, 2022
    By admin1
  • Fashion

    Counterfeiting in the Fashion Industry – India

    September 6, 2022
    By admin1

You may interested

  • Science & Tech

    How Science Friday Used A/B Testing To Guide Audience Engagement

  • Science & Tech

    San Diego County Teacher of the Year Award, including language, science, and physical education instructors

  • Science & Tech

    Master of Science in Product Innovation Program, Walton College

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,345)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Tom Ford Offers Sexy Nightcaps to New York Fashion Week

    By admin1
    September 16, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy