Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

All
Home›All›Former Apple VP of Global Marketing Joins Inery as Principal Advisor to Drive Mainstream Recruitment

Former Apple VP of Global Marketing Joins Inery as Principal Advisor to Drive Mainstream Recruitment

By admin1
September 21, 2022
453
0
Share:

[ad_1]


Enter Wall Street with Street Insider PremiumRequest your 1 week free trial here.


SINGAPORE, Sept. 21, 2022 (GLOBE NEWSWIRE) — SINGAPORE, SEPTEMBER 21, 2022: Satjiv S. Chahil, former Senior Vice President of Global Marketing at Apple, has joined the Inery team as a new Principal Advisor and brings you an irreplaceable experience. The company’s first listing will be on Huobi on September 28th.

“Having someone like Satjiv in my corner, I know I’m doing something right. I’m proud to have him on our team. With him, he will help Inery streamline its transition from the Web2 to the Web3 space and mass adoption of distributed data management.”

Satjiv is a Silicon Valley digital marketing pioneer, innovator and thought leader with over 40 years of experience in commercializing technology and driving startups to scale. Previously he was Global Marketing and Corporate at Apple Inc. He was Senior Vice President of Communications He was President and Chief Marketing Officer at Newbridge Networks and Palm Inc., some of Silicon Valley’s most prominent companies. led to success. ‘ in the field of digital marketing.

During his tenure at Apple, Satjiv Chahil has contributed to partnerships with entertainment media companies, working with the creative community, and recording artists and labels. Also, during his time at IBM, he played a key role in his first ATM launch and adoption of barcode technology. His tenure as Senior Vice President of Marketing at Hewlett-Packard (HP) His tenure as President and Head of the SME Division has helped the company achieve a top spot in the global PC market .

He has also held leadership and advisory positions with leading companies such as Xerox, BMW, Beats by Dr. Dre, Quickoffice (formerly Mobile Digital Media), Sony, Starkey Hearing Technologies, TechCrunch, Engadget, Mercedes, Omnicell and Swarovski. I was.

Satjiv brings his extensive experience to Inery as a Principal Advisor to help achieve Inery’s mission to globally decentralize data. Chahil brings invaluable expertise and insight to help Inery’s solutions become mainstream and make a lasting impact in the Web2 and Web3 space.

About Innery

Inery is a decentralized data system and blockchain solution. This project integrates key features of blockchain to facilitate immutability, security, and user-controlled data assets using its infrastructure, enabling high throughput, low latency, and complex query capabilities. to

Apart from leading solutions for database management, Inery also integrates new blockchain networks with unmatched speed, leading architectural solutions and high scalability for deploying decentralized applications.

For more information on Inery, please visit:

website | telegram | twitter | cacophony | instagram | medium

Tijana Gertner
Director of Marketing & PR
INERY PTE LTD.
tg -at- inery.io

primary logo

Source: Innery



[ad_2]

Source link

Tagsapplebmwcommunitycreativeeventfacebookfreeinstagrammarketingmynewsingaporestreetsuccessteamthetimetopyou
Previous Article

Vanguard Online Marketing Offers Surefire Digital Marketing ...

Next Article

Doctors suffer in silence due to social ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    Jackson’s Women’s Goals Heading to Miss Michigan Pageant Are Mental Health, Women’s Support

    August 19, 2022
    By admin1
  • Science & Tech

    Randall Munro Answers Absurd Science Questions

    September 24, 2022
    By admin1
  • All

    Stagwell’s (STGW) PROphet Adds Key Sales and Marketing Staff to Meet Growing Customer Demand

    August 16, 2022
    By admin1
  • Science & Tech

    AMDL Circle forges a home for science in a sculptural lattice with the Novartis Pavilion

    August 22, 2022
    By admin1
  • Fashion

    90s Fashion: Summer Street Style in Claudia Schiffer’s Iconic Outfit

    August 26, 2022
    By admin1
  • Travel & Lifestyle

    Hate in Disguise: The Canadian Anti-Semitic Education Foundation is About Anti-Palestinian Racism

    September 5, 2022
    By admin1

You may interested

  • Science & Tech

    Australian Science Celebrates India’s 75th Anniversary of Independence

  • Science & Tech

    What animals could be extinct by 2050?

  • Science & Tech

    Best Workouts to Slow Aging and Promote Longevity, Science Reveals — Eat That, Not This

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Focused Image Wins 6 New GovCon Clients in 60 Days and Continues Growth Momentum

    By admin1
    September 7, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy