Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Unlock the Freedom to Explore New Cities at Your Own Pace with ...

      May 22, 2025
      0
    • TUI Cars - Zuverlässige globale Autovermietung für flexibles Reisen mit allem Drum ...

      May 22, 2025
      0
    • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

      May 18, 2025
      0
    • Travel in Style and Comfort with Europcar’s Wide Range of Premium Vehicles

      May 18, 2025
      0
    • From Business Trips to Scenic Escapes – Europcar Delivers Every Time

      May 18, 2025
      0
    • Experience Seamless Mobility Across Continents with Europcar’s Global Fleet

      May 18, 2025
      0
    • Unlock Limitless Travel Possibilities with Europcar’s Flexible Rental Solutions

      May 18, 2025
      0
    • Unwind in Style: Discover the Luxury and Charm of the QHotels Collection ...

      May 15, 2025
      0
    • Experience The Heart Of The City Through Cutting-Edge Interactive Technology

      May 15, 2025
      0
  • Fashion
    • L'ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

      May 18, 2025
      0
    • Erhöhen Sie Ihr Schuhspiel: Herren-Barfußstiefel von Groundies

      May 15, 2025
      0
    • Treten Sie ein in die Welt minimalistischer Barfußschuhe für ultimative Freiheit und ...

      May 15, 2025
      0
    • Luis Trenker Kleider: Entworfen für Frauen, die sich trauen, aufzufallen

      May 14, 2025
      0
    • Laufen bei jedem Wetter: Entdecken Sie die besten Laufjacken bei Laufbar

      May 14, 2025
      0
    • Laufen mit Komfort und Stil: Entdecken Sie die besten Laufschuhe bei Laufbar

      May 14, 2025
      0
    • Améliorez votre condition physique avec Myprotein : Les meilleures ventes de vêtements ...

      May 10, 2025
      0
    • Elevate Your Wardrobe with Fruugo: A Vast Selection of Women’s Shoes for ...

      May 8, 2025
      0
    • Enhance Your Golf Game and Style with Premium Men’s Headwear from Discount ...

      May 5, 2025
      0
  • Health & Beauty
    • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana - Bottega Verde: Bellezza naturale ...

      May 22, 2025
      0
    • L'ARISÉ Damenduftkollektion: Eleganz in jeder Note

      May 19, 2025
      0
    • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

      May 19, 2025
      0
    • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

      May 19, 2025
      0
    • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

      May 18, 2025
      0
    • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

      May 18, 2025
      0
    • Fitness Trifft Innovation: Die Speediance Revolution Beginnt Jetzt

      May 15, 2025
      0
    • Erleben Sie die Kraft natürlicher Inhaltsstoffe in den MiiN-Körpercremes

      May 15, 2025
      0
    • Vom Bauernhof zur Verpackung: Das Engagement von Lucky Hemp für hochwertige CBD-Blüten

      May 15, 2025
      0
  • Science & Tech
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
    • Revolution beim Kochen im Freien: Rüsten Sie sich mit Ration1.de Essentials

      December 23, 2024
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana – Bottega Verde: Bellezza naturale dalla Toscana

  • Unlock the Freedom to Explore New Cities at Your Own Pace with Convenient Vehicle Rentals

  • NINJA Küche Deutschland: Intelligente Geräte, die den Kochalltag verändern

  • TUI Cars – Zuverlässige globale Autovermietung für flexibles Reisen mit allem Drum und Dran

  • Die besten Porzellan-Geschirrkollektionen für alle, die Wert auf Design und Alltagstauglichkeit legen

  • Egret Elektro-Roller und Zubehör: Erhöhen Sie Ihre Fahrt mit Innovation und Stil

  • My Egret – Intelligente Mobilität mit Stil und Präzision neu definiert

  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

Science & Tech
Home›Science & Tech›What animals could be extinct by 2050?

What animals could be extinct by 2050?

By admin1
September 19, 2022
320
0
Share:

[ad_1]

There have been five mass extinctions in Earth’s history, and many experts have issued alarms. A sixth mass extinction may already be underway As a result of human activity since the Age of Discovery. Some scientists Almost 40% of seeds (opens in new tab) Organisms currently living on our planet could become extinct as early as 2050.

But is this just the worst case scenario? earthspecies can occur?

Related: Could climate change wipe out humans?

increase in death toll

A sixth mass extinction is definitely plausible, said Nick Lawrence, director of the Otago Institute of Paleogenetics and senior lecturer in antiquity. DNA in the Department of Zoology, University of Otago, New Zealand.

“I think it’s pretty likely,” Lawrence told Live Science in an email. bottlenecks, may go through local extinctions and become functionally extinct, the current threat of extinction may not have reached the height of the Big Five, but to stop it If you don’t do anything, you’re definitely on track.”

According to the International Union for Conservation of Nature (IUCN), Red List of Threatened Species (opens in new tab)about 41,000 species — nearly a third of all species assessed — are currently threatened with extinction.

Sumatran orangutan (Pongo Avery), Amur Leopard (Panthera pardus orientalis), Sumatra elephant (Elephas maximus sumatranus), black rhinoceros (Dikelos Bicornis), Hawksbill (Eretmochelys imbricata)Sunda tiger (Panthera Tigris Sondaika) and Cross River Gorilla (gorilla gorilla dieri) — classified as “endangered” by both the IUCN and the International Union for Conservation of Nature.This means that it is highly endangered in the wild. World Wildlife Fund (opens in new tab) (WWF).

A baby Sumatran orangutan snuggles up to its mother.

A baby Sumatran orangutan snuggles up to its mother. (Image credit: Anup Shah via Getty Images)

The IUCN describes it as endangered. (opens in new tab) “categories containing species at very high risk of extinction as a result of rapid population declines of more than 80% to 90% over the last decade (or three generations), current populations of less than 50 individuals, or other factor.”

Many of these species are so severely threatened that they may not survive until 2050.focoena sinus), the porpoise species, considered the rarest marine mammal in the world, has been reduced to just 10 individuals. According to WWF (opens in new tab).

There are countless lesser-known species at risk.2019 review published in the journal biological conservation (opens in new tab) Finding that more than 40% of insect species are currently threatened with extinction, researchers urged “more sustainable and ecologically-based practices to slow or reverse current trends.” He said it should be fully adopted. Reduce insect populations and protect the important ecosystem services they provide. ”

Grasshopper with a white tip (Chorthippus acroleucus), Southern Alpine Bush Cricket (Anoconotus apeninigenus), Swanepoel’s Blue Butterfly (Lepidochrysops swampoeri), Franklin’s bumblebee (bombas franklini) and the Seychelles wingless groundhopper (Procytettix fusiformis).

Related: Which species did humans first drive to extinction?

The same dire prediction of rapid decline exists for nearly all life on Earth. According to a 2018 report (opens in new tab) According to the Intergovernmental Panel on Climate Change (IPCC), the world’s coral reef Even if global warming is limited to 2.7 degrees Fahrenheit (1.5 degrees Celsius), they could be extinct by 2050. Recent IPCC (opens in new tab) But the report goes even further, finding that if global temperatures rise by 1.5°C by the early 2030s, “99% of the world’s coral reefs could experience frequent and irreversible heatwaves.” suggesting.

Ribbon Reef No 9, Great Barrier Reef, Australia.

By 2050, more than 90% of the world’s coral reefs could be dead. (Image credit: Lea McQuillan/500px via Getty Images)

According to a 2022 report published in the journal Nature (opens in new tab)a report published by the journal in 2016, while two in five (40.7%) amphibians are currently threatened with extinction. biology letter (opens in new tab) states that by 2050, 35% of frogs in the Wet Tropics of Queensland, Australia, “may be threatened with extinction.” In fact, amphibian decline could be even more pronounced. Scientists admit there are many amphibians that they struggle to gather detailed information about, and these species are classified as data deficient (DD). According to a report published in the journal in 2022 communication biology, (opens in new tab) “85% of DD amphibians are potentially endangered, as are more than half of DD species in many other taxa, such as mammals and reptiles.”

Determining the exact number of species likely to become extinct by 2050 is therefore very difficult, mainly because the scale of extinction has not yet been established. Furthermore, it is almost impossible to identify all endangered organisms, as it is not known how many species currently exist.

Part of the reason is that “taxonomy, the science of naming biodiversity, is so underfunded,” Lawrence said. “If you can’t name biodiversity (or if you can’t name it fast enough before it goes extinct), you can’t determine how many species will go extinct.”

Extinction happens naturally, but— Over 99% of all species (opens in new tab) Human activity can dramatically accelerate the rate of species extinction. This is a familiar idea for New Zealander Lawrence.

“Island ecosystems are a perfect example to illustrate this,” he said. “They are isolated and often contain high levels of endemism (that is, endemic wildlife).” species, and about 80 species of birds have been lost, Lawrence said.

Related: How long do most species survive before going extinct?

Given the time, many species can adapt to climate change and changes in their natural environment.2021 study in the journal Ecology and evolutionary trends (opens in new tab) Some animals were found to be ‘shifting morphology’ to cope better climate change, some birds seem to be the most adaptable. Studies show that several species of Australian parrots have evolved over the past 150 years to increase their beak size and better regulate internal body temperature.

But as human activity accelerates climate change and destroys habitats, some of the most vulnerable species may bear the brunt and become unable to adapt.

What can you do?

With so many species now on the brink of extinction, is there anything we can do to prevent the worst-case scenario?

For one thing, “the conflict between short-term political interests and long-term funding for conservation initiatives needs to be resolved,” Lawrence said. Many of them are only surviving on intensive conservation management, and the situation will change dramatically as governments, public will and resources are eroded.”

Of course, there are many organizations, researchers and projects dedicated to slowing or stopping human-related climate change. Climb Works (opens in new tab)The Swiss-based company is a pioneer in the field of carbon dioxide air capture technology and aims to build a series of facilities that can permanently remove CO2 from the air. was established in

Elsewhere, Project drawdown (opens in new tab)is a non-profit organization founded in 2014 that aims to connect professionals around the world to help propose and test concepts for stopping. greenhouse gas We’ll see them eventually decline while Bill Gates backs them up Stratospheric control perturbation experiment (opens in new tab) We are currently assessing the feasibility of spraying non-toxic calcium carbonate (CaCO3) dust into the atmosphere to reflect sunlight and thereby offset (or significantly reduce) the effects of global warming. .

In the meantime, Lawrence said, to know the future of the planet, we need to look to the past.

“To save the biodiversity we leave behind, we need to know how it has responded to past and present climate change and human impacts, supported by evidence-based conservation management strategies. We need to be able to predict how they will react in the future,” he said. .

In short, more research and effort is needed before it’s too late.

Originally published in Live Science.

[ad_2]

Source link

Tagsanimalsaustraliababyblackbluebodyhistorylifelivelooknaturalnaturenewperfectprettyredtimewhitewildlifeworld
Previous Article

OC Fashion Week Announces July 2023 ‘Fashion ...

Next Article

Poultry Science graduate student wins research award ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Black women have always ’embodied’ fashion and style

    September 10, 2022
    By admin1
  • All

    Build a digital marketer mindset

    November 23, 2022
    By admin1
  • Science & Tech

    Students are focusing on ‘mystery science’ at a school in the city of Kalman.news

    September 15, 2022
    By admin1
  • Travel & Lifestyle

    Ministry of Education proposes plan to curb K-4 literacy crisis

    September 26, 2022
    By admin1
  • All

    Sam’s Club expands retail media offerings to aid product discovery

    September 19, 2022
    By admin1
  • All

    Sri Lanka Marketing Institute Launches SLIM DIGIS for Fourth Consecutive Year – Adaderana Biz

    September 26, 2022
    By admin1

You may interested

  • Science & Tech

    Today’s D Brief: Sweden’s PM to the WH; Erdogan still blocking NATO expansion; Israel buys more F-35s; State’s Afghan withdrawal review; And a bit more.

  • Home&LivingScience & Tech

    Keep Your AEG Appliances Sparkling with Genuine Cleaning Products

  • Science & Tech

    Ohio to host science park for space research

Search

Categories

  • All (1,238)
  • Animal Food (17)
  • Books & Novels (14)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (6)
  • Export Test (21)
  • Fashion (1,690)
  • Fitness & Health (17)
  • Food & Drinks (15)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,576)
  • Health & Beauty (20)
  • Home&Living (208)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (4)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,344)
  • Sports (21)
  • Technology (151)
  • Travel & Lifestyle (5)
  • Travel & Lifestyle (1,613)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana – Bottega Verde: Bellezza naturale dalla Toscana

    By admin1
    May 22, 2025
  • Unlock the Freedom to Explore New Cities at Your Own Pace with Convenient Vehicle Rentals

    By admin1
    May 22, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • DU’s Bharati College Launches Online Course “Digital Marketing and Social Media Advertising”

    By admin1
    September 25, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy