Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Travel & Lifestyle
Home›Travel & Lifestyle›Shining a Light on K-12 Education

Shining a Light on K-12 Education

By admin1
September 18, 2022
483
0
Share:

[ad_1]

If you have a student or teacher in your family, or know someone who is a student, teacher, school bus driver, or works in a school district or field of education, you have experienced the disruption caused by the COVID-19 pandemic. When youth education is affected, so are our communities.

A recent report by McKinsey & Company, a trusted research and consulting firm, found that the educational impact of COVID-19 is having knock-on effects for families, health and local economies. The ripple effect could have long-term implications for all of her 18 cities and her 800,000 residents in Snohomish County.

Based on The Daily Herald’s recent community survey and feedback we’ve heard through our hosted conversations, residents can learn what’s happening in their education, what’s working and what’s not. Without information about the challenges facing K-12 education and possible solutions, it is difficult to make informed decisions and take action.

The Daily Herald is a leading source of news, sports and other information in Snohomish County, but for years it has not had the resources to staff a reporter devoted to the educational beat. We expected community reporters to lag behind, but in a county with 15 public school districts (small to rural, large to urban) and dozens of private schools, , a dedicated reporter rather than a piecemeal approach to reporting such an important beat.

The Daily Herald has been selected to participate in the Report for America program for our community in need of more information on K-12 education. Report for America is a national service program that places emerging journalists in communities with coverage gaps that local newspapers alone cannot fill.

Through the Report for America program, Herald hired Mallory Gruben. He began covering educational beats in his June. The Herald News Since joining his team, Gruben has delivered stories that otherwise couldn’t have been told. She reported on a new law requiring school districts to add mental health as a reason for absence, the impact of failing to meet two levies on Marysville education, the impact of the pandemic on students, and staff shortages. , more.

Gruben also encourages conversation and connection. She’s been out in our community talking to school district superintendents, school board members, educators, parents, and students. She told me that she handed out her business cards along with invitations to talk about her education over coffee.

Mallory Gruben

Mallory Gruben

As part of the Report for America program, Gruben is required to provide community service outside of normal business hours. Her Ideal Volunteer Her project is for middle school students to learn the basics of journalism and ignite her passion for reporting in the community.

The Report for America program not only gives local newspapers the opportunity to hire emerging journalists, it also helps raise funds. The program pays a portion of the salaries of its members and asks the community to come up with the rest. Report for America believes communities should invest in local journalism that benefits them.

The entire community needs to raise approximately $62,000 to fund the Report for America challenge of investing in local education. This will fund work on Gruben’s educational beat through May 2023. However, the need for educational reporting will continue beyond that, requiring ongoing funding for philanthropy.

When individuals, businesses and foundations stand up to support community journalism, we all support the well-being of our communities. Now that K-12 education is back in full swing, it’s the perfect time for all of us to contribute to the work of shining a light on education. It’s a way for people working on education challenges, solutions, and for all of us to participate.

To donate now, visit heraldnet.com/education-project-fund.

Thank you very much.

Thank you to everyone who participated in our first Community Conversation with Executive Editor Phil O’Connor in August. Local welcomes your candid opinion on his journalism. If you’d like to join him for his next online Community Conversation on September 29th from 11:30am to 12:15pm, register now at heraldnet.com/conversation-september.

Brenda Mann Harrison is the Journalism Development Director for The Daily Herald. She writes “Local News Impact” to raise awareness of how the community is supported. Journalism benefits Snohomish County. For more information, please donate now. You can contact Brenda at heraldnet.com/local-news-impact. brenda.harrison@heraldnet.com or 425-339-3452.Daily Herald says: Editorial control of content created with resources from journalism foundations.




[ad_2]

Source link

TagsBusinesscoffeecommunitydailyeducationfamilyhealthlightmenewnewspassionpeopleperfectschoolsportsthetimeurbanwork
Previous Article

KOOTENAI HEALTH: should be 501c3

Next Article

Ghana Education Community Empowers Children

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    Who Benefits Most From Student Loan Forgiveness

    September 11, 2022
    By admin1
  • All

    Ready to use AI for your marketing copy?

    September 13, 2022
    By admin1
  • All

    38 Digital Market, a Leading Cleveland Digital Marketing Agency, Secures New Clients with Thryve Group LLC

    September 13, 2022
    By admin1
  • Health & Beauty

    Capito, colleagues introduce bipartisan law to improve mental health on college campuses

    September 29, 2022
    By admin1
  • Fashion

    Native-owned fashion in Marvel’s She-Hulk

    September 1, 2022
    By admin1
  • All

    HI LIFE grants Connect Digital as a Digital Marketing AOR.

    August 30, 2022
    By admin1

You may interested

  • Science & Tech

    College dropped out of science business major – The Observer

  • Science & Tech

    Form Bio spins out of bioscience giants to give scientists the ‘missing piece’. It’s a Complete Software Solution for Life Sciences » Dallas Innovates

  • Science & Tech

    Science Links of the Week » Explorersweb

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (52)
  • Gift Guides (23)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Feeding the Wild Right at Home with Garden Wildlife Direct

    By admin1
    April 6, 2025

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy