Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Fashion
Home›Fashion›A Run Down of Every Kylie Jenner Fashion Week Look 2024

A Run Down of Every Kylie Jenner Fashion Week Look 2024

By admin1
January 30, 2024
436
0
Share:

[ad_1]

Photography courtesy of Getty Images

Kris Jenner works hard, but her daughter’s stylists work harder.

By
Natalie Michie

Date January 29, 2024

For the pop culture-obsessed, there is almost too much to keep up with these days. Barbie discourse! Celebrity lip-reading kerfuffles! Zendaya’s new bangs! One thing that we simply cannot allow to get lost in the shuffle? Kylie Jenner and her masterful fashion week looks.

ICYMI, Ms. Jenner has been going through something of a style shift as of late. After moving into minimalism in 2023 and bringing us back to the 2010s with pink hair at the top of the new year, the beauty mogul is now ubiquitous at fashion month. Taking a break from accompanying Timothée Chalamet to awards shows, the 26-year-old is currently in France, garnering gasps with every front row she graces. And there have been, as the French say, beaucoup.

Look no further than the Jacquemus show on January 29, where she sported a red fitted mini dress from the label’s new collection. Featuring a chest slit cutout and a chiffon overlay, Jenner pulled off perfect colour-coordination with her daughter Stormi.

And there is more where that came from. It appears Jenner, who reportedly works with sister styling duo Alexandra and Mackenzie Grandquist, has been on a mission to bring opulence to every outing.

The week before, she started off her stay in Europe with a (literal) bang: debuting a side-swept micro-fringe. Sported alongside an off-the-shoulder sheer skintight dress, this Parisian hairstyle served as a harbinger of OTT glamour to come.

Kylie Jenner fashion week looks
Photography by Getty Images

On January 24, she attended the Jean-Paul Gaultier by Simone Rocha show in a corset dress with a gauzy overlay. Sitting next to Kelly Rutherford (Gossip Girl icon and Instagram It girl), Jenner exuded undeniable Upper East Side luxury.

Kylie Jenner fashion week looks
Photography courtesy of launchmetrics.com/spotlight

Later that evening, she was once again accompanied by Stormi for her next outing. Headed to the Valentino show, the pair coordinated in black dresses with feathered detailing. For maximum diva effect, both wore dark sunglasses — despite the sun having very much set.

The following day, Jenner turned up the dial on the silver trend in a metallic dress festooned with scale-like sequins. Sporting soaking-wet hair, she drove home the otherworldly effect with a pair of ruched tulle opera gloves. Are they a stunning accoutrement? Yes. Will serve as an obstacle when it comes to scratching an itch or eating a snack? Absolutely. Slaying is thankless work!

Kylie Jenner fashion week looks
Photography courtesy of launchmetrics.com/spotlight

Over the weekend, Kylie Jenner took a break from fashion week front-row duties. Instead, she went for dinner in many a jaw-dropping ensemble, from a crushed velvet vintage Alaïa set to a MM6 Maison Margiela babydoll dress with knee-high tan boots.

Say what you will about Kylie Jenner, but her fashion week outfits make waves. She debuted an animal head at Schiaparelli! She was an early adopter of the no-pants trend at Loewe! Her schedule may be packed between promoting Khy and attending Wonka screenings, but Jenner will always make time to turn heads with her style.

What’s next? The return of that one shockingly vibrant turquoise wig? We can only pray.

More Celebrity Style

Celebrity Style

By
Natalie Michie

Date January 23, 2024

Celebrity Style

By
Katherine Singh

Date January 16, 2024

Celebrity Style

By
Jennifer Berry

Date January 16, 2024



[ad_2]

Source link

Tagsbeautyblackdinnerdressfashiongirlhairhomeinstagramlookluxurynewphotographypinkredstyletrendvintageweekendwork
Previous Article

Dear Abby: Man chooses to feed vices ...

Next Article

Vitabiotics’ Best-Sellers: From Wellwomen Gummies to Pregnacare ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • All

    Get Pixabiz launches cheap website builder service

    September 13, 2022
    By admin1
  • All

    Voice Media Group Named Top Employer for 2022

    September 21, 2022
    By admin1
  • All

    Adapt your digital marketing strategy to post-pandemic consumer behavior

    June 30, 2022
    By admin1
  • Health & Beauty

    Where is Amazon Heading After Amazon Care’s Failure?

    August 28, 2022
    By admin1
  • Health & Beauty

    Meet Boston Police Officer Ben Lynskey and Bring His Mental Health Background to the Streets

    August 28, 2022
    By admin1
  • Fashion

    Los Angeles designer says ever-evolving fashion aesthetics have a constant impact on interiors

    August 22, 2022
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Integrating coding into chemistry accelerates scientific progress.opinion

  • Science & Tech

    Mississippi Science Fest returns to the capital September 15-17

  • Science & Tech

    Tom Still: Spurring National Science Goals, Wisconsin Group Thinks Beyond Geography | Business News

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Thompson Health Hosts Nursing Wellness Event Lifestyle

    By admin1
    September 17, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy