Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Fashion
Home›Fashion›Clare Waight Keller Uniqlo: The Designer on Her Uniqlo C Collection

Clare Waight Keller Uniqlo: The Designer on Her Uniqlo C Collection

By admin1
September 8, 2023
519
0
Share:

[ad_1]

Photography courtesy of Uniqlo

The legendary luxury designer is back with a line of everyday affordable essentials. Here, she reveals why.

By
Natalie Michie

Date September 8, 2023

These days, picking out clothes can be a bit of a conundrum. Whether you’re working from home, commuting to the office, or oscillating between both, piecing together the “right” outfit to face the day looks different in a post-COVID era. Famed designer Clare Waight Keller has been pondering that a lot lately.

RELATED: Red Accessories Are the Key to Fall Dressing

“I think the idea of having office wear or home wear or weekend wear is gone. It’s all blended into one,” she says at a press event on a sunny afternoon in Paris. The British artistic director — whose resume includes helming Chloé and Givenchy as well as designing Meghan Markle’s wedding dress — is here to discuss her new womenswear label with Uniqlo, entitled Uniqlo: C. (“C” for chic, casual, commuting, and yes, Clare.)

Photography courtesy of Uniqlo

The colourful 30-piece capsule collection is meant to take you from the couch to the city, with key pieces like wrinkle-proof pleated skirts, all-season oversized trenches, and pullover sweaters that can be layered with ease. Waight Keller looks sartorially serene, sporting the line’s billowing Printed Chiffon Pleated Dress (which retails at a palatable $79.90). “The dress I’m wearing has strings so that you can bring it in and out. The skirts have elastic bands. Everything has a sense of movement and softness to it,” she explains. These intentional subtleties are a styling saving grace, and they’ve become her calling card.

Photography courtesy of Uniqlo

When the aforementioned Duchess of Sussex emerged in a design by Waight Keller for her 2018 wedding, she was not in a traditional ruffle-adorned royal frock but a minimalist gown with sobering clean lines. Waight Keller established a similarly refined legacy at Chloé from 2011 to 2017, where she championed romantic fluidity with boyish tailoring. As the first female creative director at Givenchy until 2020, she redirected the label’s gothic sexiness into a realm of feminine elegance. Now, this luxury philosophy has gone global. “Femininity is something that I’ve always had in my work… and I felt that that was something that I could bring to Uniqlo that speaks to my world and my vision,” she says.

Uniqlo C
Photography courtesy of Uniqlo

With other collaborations like Marni, JW Anderson and Jil Sander under its belt, the Japanese retailer has been secretly working with Clare Waight Keller for the past two years on this release. Rooted in the ever-evolving idea of the “modern woman,” the label exudes a mix-and-match versatility that, in today’s getting-dressed landscape, is more valuable than ever.

Ahead of its release on September 15, FASHION spoke with Clare Waight Keller about the inspirations behind Uniqlo C, the power of calmness, and what a “modern woman” looks like in 2023.

A focus of this collection is curating an “effortless” wardrobe. What do you see as some of the challenges women face when getting dressed, and how do you address them with Uniqlo C?

[There are] lots of challenges in getting dressed today. When you imagine how life has changed now that everyone is working via their phones, from home or going to the office, we’re all operating in so many different dimensions… You need clothes that look chic but are comfortable enough to wear at home, to commute to the office, or even to travel. I’m constantly travelling now, so I need clothes which can be packed easily. All of these aspects of multifunctionality have been a part of creating this capsule.

Uniqlo C
Photography courtesy of Uniqlo

How does this collection borrow from your previous roles at the helm of luxury brands?

A lot of the details that are in the collection have been signatures in my previous roles. At Chloé, I used a lot of fluidity and pleats. So I worked quite carefully over a long period of time with them because pleats are not a typical fabric texture that [Uniqlo works] with. Finding the right fabric that could do the pleating, do the micro-pleating, and have drawstrings… it took several tries to get it right. There were all these details that I had prior experience and knowledge of from working in France that I was able to bring to them in Tokyo.

Uniqlo C
Photography courtesy of Uniqlo

The fluidity of the collection evokes a sense of serenity. You’ve been described as calm by your industry peers. How does that trait inform your design process?

It’s true. I mean, I think that’s what everyone’s looking for in their lives, actually. You want to be able to open your wardrobe doors and think, “OK, I could put that with that. Or, today, I want to add that with that.” The most challenging thing for women is that there’s so much choice out there that sometimes it’s quite difficult to get dressed in the morning. There’s also this sense of being very self-conscious. I wanted the idea of effortlessness… For me, it’s a lot about feeling and emotion when you get dressed. Sometimes you feel good, and sometimes you don’t, because those are the ups and downs of being a woman who’s working and who has many things going on in her life. So if clothes can help, then that’s an amazing asset.

Uniqlo C
Photography courtesy of Uniqlo

While there’s a focus on femininity, there’s also a sense of androgyny via boyish-cut trousers and boyfriend pullovers. Why was that important for you to have?

That kind of crossover mix has always been part of my DNA and aesthetic. In my past working in menswear, I just loved having that slight rigour of the men’s tailoring to contrast with femininity. I also think it looks really modern on a woman to be able to have that kind of boyish blazer over a skirt. It just feels fresh, and I think it gives a lot of different aspects to your wardrobe. You can dress it in different ways but still feel feminine.

It’s refreshing to see menswear elements as pillars of a collection that emphasizes the “modern woman.” It seems like this image is very much tied to gender fluidity.

It is. Ever since I put the announcement post up on Instagram, I’ve had a lot of men sending messages saying, “When can I wear men’s?” or, “Can I wear the collection?” The interesting part is that a lot of what I’ve designed has been boxy or oversized. So by buying a few sizes up, anyone could wear it, which is really nice.

This interview has been edited and condensed for clarity. 

This article contains affiliate links, so we may earn a small commission when you make a purchase through links on our site at no additional cost to you.

[ad_2]

Source link

Tagsamazingdesignfashionhomeinstagramlandscapelifelookluxurymenewoutfitparisphotographyredtravelweddingweekendworkworld
Previous Article

TikTok Shop marketplace is full of cheap ...

Next Article

Sofia Richie Grainge Is a David Yurman ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Dress with a smile: Fashion’s new fixation on dressing like the dentist | Fashion

    August 19, 2022
    By admin1
  • Travel & Lifestyle

    Macon County School Board Vice Chairman Dies at 79

    September 8, 2022
    By admin1
  • Fashion

    Luxlock Uses Unlockable Physical NFTs to Move Designers Off the Runway During Fashion Week

    September 16, 2022
    By admin1
  • Science & Tech

    Wellbeing subsidiary KGK Science opens new clinical research center to reimagine a healthier future.work

    September 26, 2022
    By admin1
  • Science & Tech

    Board Amends Ordinance Related to Proposed Life Science Center

    August 24, 2022
    By admin1
  • Science & TechTechnology

    KCOM: Pioneering High-Speed Broadband and Telecom Services in Hull and Beyond

    December 5, 2024
    By admin1

Leave a reply Cancel reply

You may interested

  • Science & Tech

    Former Green Party leader goes back to roots, seeks solutions through climate science

  • Science & Tech

    Elon University / In Elon Today / Elon Family Award Scholarship Honoring Exercise Science Professor Joyce Davis

  • Science & Tech

    Science education! why? | | News

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Become the face of Tohoku recruitment news!

    By admin1
    August 26, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy