Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Science & Tech
Home›Science & Tech›Rachel Hilliam, Chair, Alliance for Data Science Professionals

Rachel Hilliam, Chair, Alliance for Data Science Professionals

By admin1
September 30, 2022
530
0
Share:

[ad_1]

Rachel Hilliam, president of the Alliance for Data Science Professionals, says it’s unusual for societies like the Royal Statistical Society (RSS), BCS and Institute of Maths and its Applications (IMA) to collaborate on professional certification .

Hiriam is Professor of Statistics in the Department of Mathematics and Statistics at the Open University (OU) and is first and foremost a statistician. She has been with OU since 2011, and prior to that she was the sole medical statistician at Derby Hospitals Trust, involved in numerous research projects and clinical trials.

She is also Vice President of the Royal Statistical Society and focuses on professional issues.

Hilliam recalls that in 2019 there was a lot of discussion about the rise of data science as an interdisciplinary field among the academic societies backing the new alliance, mainly RSS, BCS and IMA. The Need for Specialization of Data Scientists”.

She adds: This kind of collaboration between associations was very new. In fact, many conversations took place before we even got to the process of formally deciding what the Alliance was and even if it was something that could be done between societies. ”

The Alliance will certify its first cohort of data scientists in July 2022 to meet the discipline standards agreed between the RSS, BCS and IMA as well as the Operational Research Society, the Alan Turing Institute and the National Physical Society. I acknowledged that Institute (NPL). A total of 13 data scientists were certified, all experienced and well-rounded, with an approximate 50/50 male to female ratio.

The Alliance hopes to present an early carrier certification later this year, but Hilliam says the initiative is in the early stages of how to get to market.

The Chartered Institute for IT’s BCS flagged the Alliance as a component of six technology priorities proposed by Conservative MPs during the election of Prime Minister Liz Truss. The data science profession, it said, was “the key to economic growth.”

“The government needs to work with the Alliance to ensure the UK has a strong pipeline of trusted data scientists to drive economic growth.”

Rachel Hilliam, Data Science Professional Alliance

It drew attention to the “Alliance for Data Science Professionals co-founded by BCS,” which it said “gave a new bar for the first group of data scientists this year,” adding: A pipeline of trusted data scientists to drive economic growth. ”

Mr Hilliam said: And while each of these individual associations would support those people and organize events for those people, what none of the associations had was a professional organization for those individuals. It was not a certified route.

“RSS has a ‘certified statistician’ route, some data scientists fit that, but certainly not all. BCS has something similar, we have certified IT professionals What we wanted to do was not to create a new data science society as a series of societies, but to come together and have one professional channel that all those societies could sign.

“What the Alliance does not have is a chartered status as it involves a rather lengthy process by the Privy Council. But for the time being we have set this up as a certificate.”

The Turing Institute and NPL are partners in this venture, but have only recently been involved in setting standards, not accreditation.

It is hoped that the certification process will help companies hire bona fide data scientists.

But what does Hilliam think data science is beyond statistics? increase. “Now, as a statistician, I would also say that a great deal of it is underpinned by very deep mathematics.”

For this reason, she says, data science is inherently interdisciplinary. “There’s so much data out there, and what you’re trying to do is definitely beyond the statistics themselves. [as a business or other organisation] Here’s my data to come up with questions you might want to answer.

“Mainly in terms of historical statistics, the first thing I thought was a question, and then I went out and collected data to answer that question. You will see a change in your way of thinking.

“I think there’s something about what fields data scientists work in, too. I mean, because whether it’s C-level or from companies to ordinary people.”

Hilliam argues that data science is more than just modern flash. “A few years ago we had the big data revolution, but it has gone very quiet,” she says. “But I think this will continue, partly because it’s not a completely new field. It’s an interdisciplinary umbrella for the different fields of statistics, applied mathematics and computing.”

There are also bachelor’s and master’s degrees in data science that have developed in recent years, including open universities.

But Hilliam also said it’s important for teenagers to understand that data science is a high-paying, intellectually fulfilling career option, much like becoming a doctor or a lawyer. says.

“I think there is so much work to be done in terms of schools, school careers departments, and educating parents about data science that 17-18 year olds don’t have in their minds because, Because no one is talking about it,” she says.

Hilliam also says it might be an area that appeals to girls and young women because of the huge design and storytelling elements.

“You see, we have the same problem of gender imbalance not only in math but also in IT,” she says. Design can mean a lot of things when a girl says she’s interested in design because it takes her away from another profession.

“And that could definitely mean design in the computer industry, and data science. If I said I was interested in design as a girl, would school push me into that field?

“I don’t think there is a definitive answer, but I do think that if you put enough effort into data science, there are ways to attract girls. Because sometimes there’s a design type of element in there.Seriously, I think there’s a way to make this profession really appealing to girls.”

[ad_2]

Source link

TagsbarBusinessdesignfitgirlgirlsmemynewpeopleschoolstrongthetimeukwomenworkyou
Previous Article

Iowa City West seniors teaching science in ...

Next Article

Chicago religious leaders plan coordinated sermons to ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    Discover the Best of Boston from Above: A Visit to View Boston

    August 7, 2024
    By admin1
  • Travel & Lifestyle

    Seamless Journeys Await: Discover the Ourbus Advantage

    November 30, 2024
    By admin1
  • Travel & Lifestyle

    GNTC celebrates 60 years of providing technical education

    September 19, 2022
    By admin1
  • Health & Beauty

    Teen Health and Wellness Summit in Jackson

    August 13, 2022
    By admin1
  • Travel & Lifestyle

    Jensen calls for investigation, school board resignation

    September 26, 2022
    By admin1
  • Travel & Lifestyle

    How to Encourage Viewpoint Diversity in Classrooms

    October 3, 2023
    By admin1

You may interested

  • Science & Tech

    Live theater, Lego science, fresh food

  • Science & Tech

    CCNY Wins $26 Million for Mount Sinai Life Science Incubator

  • Science & Tech

    How many meteorites hit Earth each year?

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • How Blood Type Affects Your Health

    By admin1
    September 23, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy