Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Unlock the Freedom to Explore New Cities at Your Own Pace with ...

      May 22, 2025
      0
    • TUI Cars - Zuverlässige globale Autovermietung für flexibles Reisen mit allem Drum ...

      May 22, 2025
      0
    • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

      May 18, 2025
      0
    • Travel in Style and Comfort with Europcar’s Wide Range of Premium Vehicles

      May 18, 2025
      0
    • From Business Trips to Scenic Escapes – Europcar Delivers Every Time

      May 18, 2025
      0
    • Experience Seamless Mobility Across Continents with Europcar’s Global Fleet

      May 18, 2025
      0
    • Unlock Limitless Travel Possibilities with Europcar’s Flexible Rental Solutions

      May 18, 2025
      0
    • Unwind in Style: Discover the Luxury and Charm of the QHotels Collection ...

      May 15, 2025
      0
    • Experience The Heart Of The City Through Cutting-Edge Interactive Technology

      May 15, 2025
      0
  • Fashion
    • L'ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

      May 18, 2025
      0
    • Erhöhen Sie Ihr Schuhspiel: Herren-Barfußstiefel von Groundies

      May 15, 2025
      0
    • Treten Sie ein in die Welt minimalistischer Barfußschuhe für ultimative Freiheit und ...

      May 15, 2025
      0
    • Luis Trenker Kleider: Entworfen für Frauen, die sich trauen, aufzufallen

      May 14, 2025
      0
    • Laufen bei jedem Wetter: Entdecken Sie die besten Laufjacken bei Laufbar

      May 14, 2025
      0
    • Laufen mit Komfort und Stil: Entdecken Sie die besten Laufschuhe bei Laufbar

      May 14, 2025
      0
    • Améliorez votre condition physique avec Myprotein : Les meilleures ventes de vêtements ...

      May 10, 2025
      0
    • Elevate Your Wardrobe with Fruugo: A Vast Selection of Women’s Shoes for ...

      May 8, 2025
      0
    • Enhance Your Golf Game and Style with Premium Men’s Headwear from Discount ...

      May 5, 2025
      0
  • Health & Beauty
    • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana - Bottega Verde: Bellezza naturale ...

      May 22, 2025
      0
    • L'ARISÉ Damenduftkollektion: Eleganz in jeder Note

      May 19, 2025
      0
    • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

      May 19, 2025
      0
    • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

      May 19, 2025
      0
    • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

      May 18, 2025
      0
    • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

      May 18, 2025
      0
    • Fitness Trifft Innovation: Die Speediance Revolution Beginnt Jetzt

      May 15, 2025
      0
    • Erleben Sie die Kraft natürlicher Inhaltsstoffe in den MiiN-Körpercremes

      May 15, 2025
      0
    • Vom Bauernhof zur Verpackung: Das Engagement von Lucky Hemp für hochwertige CBD-Blüten

      May 15, 2025
      0
  • Science & Tech
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
    • Revolution beim Kochen im Freien: Rüsten Sie sich mit Ration1.de Essentials

      December 23, 2024
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana – Bottega Verde: Bellezza naturale dalla Toscana

  • Unlock the Freedom to Explore New Cities at Your Own Pace with Convenient Vehicle Rentals

  • NINJA Küche Deutschland: Intelligente Geräte, die den Kochalltag verändern

  • TUI Cars – Zuverlässige globale Autovermietung für flexibles Reisen mit allem Drum und Dran

  • Die besten Porzellan-Geschirrkollektionen für alle, die Wert auf Design und Alltagstauglichkeit legen

  • Egret Elektro-Roller und Zubehör: Erhöhen Sie Ihre Fahrt mit Innovation und Stil

  • My Egret – Intelligente Mobilität mit Stil und Präzision neu definiert

  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

All
Home›All›Q&A: Digital Marketing Manager Jasmin Herrera on Internship at Grace & James Kids | Alumni

Q&A: Digital Marketing Manager Jasmin Herrera on Internship at Grace & James Kids | Alumni

By admin1
September 7, 2022
273
0
Share:

[ad_1]

Where did you do your internship this summer and what was your position?

I interned as a content marketing intern at Grace & James Kids, a children’s clothing retailer.

What did your daily tasks consist of?

My day job consisted of creating email marketing campaigns, primarily to promote products. This included creating and copywriting a lot of the graphics, using MailChimp to schedule and send the campaign. Email was my main focus, but I also helped create graphics for SMS marketing, Instagram, and shipping inserts.







Jasmine Herrera

How did The Red & Black prepare for what you did in your internship?

Red & Black helped me familiarize myself with MailChimp. I’m not really into the daily newsletter here, but I do know that by creating custom his emails for advertisers, displaying ads in the newsletter, and updating my subscriber list, I can help you get your news out there. I’m used to letters.

What was unexpected about your experience?

I never expected to meet one of the owners in person to brainstorm marketing campaigns and tactics and receive direct feedback from her. It was nice to see firsthand how the owner and her VP brainstorm and plan different things.

Please give some advice to students who want an internship.

My advice to students is to be prepared to show samples of your work. Whether it’s journalism, advertising, or photography, employers love to see what students have done before, and may even ask about it in interviews. In my case, I submitted a portfolio containing a marketing strategy project for my class. In an interview, the Marketing VP praised it and asked more questions about some of my projects.

[ad_2]

Source link

Tagsblackclothingdailydayfocusinstagramkidslovemarketingmemymyselfnewsnicephotographyredsummertheworkyou
Previous Article

SIMPLILERN Partners with Purdue University to Deliver ...

Next Article

Digital marketing agency GrowthX India launches social ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Mrs Prada and I: Why Theaster Gates Joined Forces with Fashion

    September 7, 2022
    By admin1
  • Fashion

    Elevate Your Style with Ethical Superstore’s Men’s Shirt Collection

    November 23, 2024
    By admin1
  • All

    Humana Insurance Partner TrueVoice Digital Marketing Agent

    September 8, 2022
    By admin1
  • All

    10 Of The Most Notable Digital Marketing Trends

    August 17, 2022
    By admin1
  • Travel & Lifestyle

    With the Barbados Ministry of Education and Science Center

    August 26, 2022
    By admin1
  • Health & Beauty

    Health and safety tents provide valuable information

    August 23, 2022
    By admin1

You may interested

  • Science & Tech

    Wellbeing subsidiary KGK Science opens new clinical research center to reimagine a healthier future.work

  • Science & Tech

    Building an $11 million Energy Frontier Research Center to advance molecular solar science

  • Science & Tech

    TUI submits environmental targets for science-based validation

Search

Categories

  • All (1,238)
  • Animal Food (17)
  • Books & Novels (14)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (6)
  • Export Test (21)
  • Fashion (1,690)
  • Fitness & Health (17)
  • Food & Drinks (15)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,576)
  • Health & Beauty (20)
  • Home&Living (208)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (4)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,344)
  • Sports (21)
  • Technology (151)
  • Travel & Lifestyle (5)
  • Travel & Lifestyle (1,613)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana – Bottega Verde: Bellezza naturale dalla Toscana

    By admin1
    May 22, 2025
  • Unlock the Freedom to Explore New Cities at Your Own Pace with Convenient Vehicle Rentals

    By admin1
    May 22, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Mediwelcome Announces 2022 Interim Results

    By admin1
    September 23, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy