Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ultimate Adventure and Sensory Exploration at Xcaret: Your Gateway to Riviera Maya’s ...

      June 13, 2025
      0
    • Thrill Unleashed – Curated Adventure Gifts for the Daring, Bold, and Wild ...

      June 12, 2025
      0
    • Explore New Roads in Comfort and Style with Europcar’s Flexible Vehicle Rental ...

      June 10, 2025
      0
    • The QHotels Collection – Luxury Escapes, Spa Breaks, and Golf Retreats Across ...

      June 10, 2025
      0
    • Caesars Unleashed – Luxury, Luck, and Legendary Escapes Await

      June 9, 2025
      0
    • Europcar Offers the Ultimate Travel Flexibility with a Wide Range of Reliable ...

      June 7, 2025
      0
    • Explore the Best Travel Insurance Options for Every Journey and Travel Type ...

      June 7, 2025
      0
    • Unlocking the Future of Longevity and Healthy Aging with Audiobooks

      June 6, 2025
      0
    • Effortless Car Rental: Making Travel More Convenient and Enjoyable

      June 6, 2025
      0
  • Fashion
    • Stylish Finds for Little Ones: Shop Pre-Loved Kids' Dresses with Purpose

      June 13, 2025
      0
    • Jeden Kilometer meistern: Laufbar Laufjacke für Herren – Unübertroffener Komfort, Stil und ...

      June 10, 2025
      0
    • Scopri profumi femminili di lusso per ogni stato d'animo e occasione

      June 6, 2025
      0
    • Shop Smart, Dress Sharp: Ethical Superstore Men’s Shirts for a Stylish and ...

      June 4, 2025
      0
    • Transform Your Wardrobe with the Unmatched Style of Dresses from WAT THE ...

      June 4, 2025
      0
    • Versatile Dresses for Every Occasion: Sustainable Fashion at Its Best

      June 4, 2025
      0
    • Explore the Best Men’s Shirts for Sustainable Travel and Style

      June 4, 2025
      0
    • Transform Your Daily Look with These Luxe Loungewear Must-Haves

      June 4, 2025
      0
    • Timeless Denim and Relaxed Fits: Discovering WAT THE BRAND’s Essentials

      June 3, 2025
      0
  • Health & Beauty
    • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

      June 12, 2025
      0
    • Verwandeln Sie Ihr Haar mit MiiN Cosmetics: Die ultimative Revolution in der ...

      June 11, 2025
      0
    • Verbessern Sie Ihre Wellness-Routine mit Lucky Hemp CBD Ölen

      June 11, 2025
      0
    • L'ARISÉ Beauty: Entdecken Sie den Reiz von pudriger Eleganz und zeitloser Raffinesse ...

      June 9, 2025
      0
    • Scopri i prodotti delicati per la cura dei capelli e per ottenere ...

      June 8, 2025
      0
    • Trasforma la tua pelle con questi prodotti idratanti essenziali – Sconti speciali

      June 6, 2025
      0
    • Le migliori soluzioni per la cura della pelle: protezione solare e sollievo ...

      June 6, 2025
      0
    • Experience Enhanced Wellness with Zooki’s Cutting-Edge Liquid Supplements Designed for Maximum Effectiveness

      June 6, 2025
      0
    • Satisfy Your Nut Butter Cravings with MyProtein’s Pure, No-Additive Spreads

      June 3, 2025
      0
  • Science & Tech
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Scoprite il futuro dell’informatica con i portatili e le workstation ad alte prestazioni di HP

  • Comprehensive Divorce Guides: How to Secure Your Financial Future During and After Divorce

  • Shop with Purpose: Oxfam’s Creative & Impactful Products

  • Ultimate Adventure and Sensory Exploration at Xcaret: Your Gateway to Riviera Maya’s Best Parks

  • Stylish Finds for Little Ones: Shop Pre-Loved Kids’ Dresses with Purpose

  • Verbessern Sie die Gesundheit Ihres Pferdes mit den natürlichen Premium-Nahrungsergänzungen von EQUIVA

  • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

  • Audible Experience Redefined – Audiobooks, Podcasts, and Endless Stories

Health & Beauty
Home›Health & Beauty›Public Health Implications of Supreme Court Decision | News

Public Health Implications of Supreme Court Decision | News

By admin1
September 21, 2022
385
0
Share:

[ad_1]

Harvard Chan School forum panelists examined how a number of recent Supreme Court rulings are having a negative impact on public health and how their advocates can counter them

September 21, 2022 – “In just seven days last June,” Michelle Williams, dean of the Harvard TH Chan School of Public Health, said, “The U.S. Supreme Court set public health back 50 years.” That sober assessment, as Williams put it, “reduced efforts to address the immediate threat of climate change, expanded access to deadly firearms and, of course, eliminated rights,” according to a recent court decision. We kicked off a September 16th panel discussion at school focused on flipping Roe vs. Wade and aborting it.

moderate washington post Columnist Dana Milbank is a panel of experts who have tackled the impact of court decisions and the further threat of affirmative action and upcoming votes on voting rights. But the event was not all gloomy and devastating. Through discussion, participants will gain hands-on, inspiring insight into how public health advocates and the general public can work to mitigate the impact of some of the most alarming changes brought about by the courts. provided the words.

Attendees didn’t hesitate when Milbank asked each of them what words they would use to describe the current Supreme Court. was Her Cecile Richards, former president of Planned Parenthood and co-founder of Supermajority. Esther Sanchez-Gomez, attorney, Giffords Law Center to Prevent Gun Violence. Leah Stokes, Anton Bonk Associate Professor of Environmental Politics at the University of California, Santa Barbara.

“This is very partisan, and not just jurisprudence, [also of] Basic human rights and accepted standards in this country no longer protect people,” Richards said. while being influenced by Dobbs overturn the decision Law vs Wade State laws banning abortion continue to get backlash, she said. The decision also resulted in a major shift in public opinion that could help mitigate the impact. “This is a long-term re-shift in voter enthusiasm,” Richards said, adding, “This is a major concern for Texas and Mississippi.” It’s not an issue, it’s people’s belief that it’s an issue that affects every family in America.”

Public opinion on climate change also suggests a disconnect with the Supreme Court, Stokes said. She noted that polls show that 70% of Americans want action to curb climate change emissions. West Virginia vs EPA Limit the government’s ability to do so. “What we’re seeing is really a minority rule,” she said. She cautioned that courts apply the principle of “major issues”. “They could say anything was a major issue,” she said. The ruling wasn’t too bad, she added, because new provisions in the Inflation Reduction Act allowed the EPA to regulate carbon pollution.

On the issue of gun rights, Sanchez Gomez noted that “there is a lot of political will to talk about modest, common sense life-saving measures” to curb gun violence. denounced the Supreme Court’s ruling in New York State, revoking New York’s Concealed Carry Act and recognizing broad rights for citizens to carry guns in public. and went so far as to ridicule the ways it is proven to reduce gun violence, deciding to elevate his own ideologically biased anecdotes above public health research,” she said. . The Bureau of Alcohol, Tobacco and Firearms still has broad regulatory authority to set rules on gun ownership at the federal level, according to Sanchez Gomez, and advocates are taking the fight directly against gun manufacturers through lawsuits. .

In the next session, the Court will consider two cases in the field of racial justice that can directly affect the health of vulnerable populations: affirmative action in schools and race-based gerrymandering. . Discussing the latter case, which involved North Carolina’s re-election, and the state’s Supreme Court ruling unconstitutional, Morial argued that legislative re-election districts were somehow subject to judicial review. “I call it ‘Hocus Pocus Logic,'” he said. He warned that by adopting such a leap of logic, the court is jeopardizing its own legitimacy and its 50-year role in helping advance civil rights in American society.

Morial and other panelists asked the public to voice public opinion against the Supreme Court’s recent decisions and on abortion rights, gun control, climate control, and other issues that could lessen the impact of those decisions. “Frankly, until Republicans start losing elections because of the very issues we’re talking about, we need She also emphasized the importance of public health research showing the impact of abortion bans and other policies on public health: It’s so important to have a medical voice in this conversation about why it’s a medical issue, not a medical issue,” she said.

“We need to connect the dots to the fact that the erosion of our rights and public health is hurting us, and use that to really inspire our activism,” Stokes agreed. participants also stressed the importance of collective action to raise public awareness and pressure authorities to act. Stokes said. “Groups can help you plug in, they can help you go to protests, they can help you work on the bill. Don’t think you have to.”

– Michael Blanding



[ad_2]

Source link

Tagsamericacaliforniaeventfacebookfamilyhealthinspirelifenewnewspeopleschoolshowtexastheworkyou
Previous Article

‘Better and fairer future’: program advances diversity ...

Next Article

Ontarios today announced that it is expanding ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    ‘We care more about guns than kids’: Former education chief

    August 22, 2022
    By admin1
  • Fashion

    Gucci loses lawsuit against quirky Japanese fashion culture

    August 30, 2022
    By admin1
  • Health & Beauty

    bet365 bonus code for USA vs. Portugal: Bet $1 on Women’s World Cup, secure a guaranteed $200 bonus

    August 1, 2023
    By admin1
  • Fashion

    Fashion District business owner fears violence near Center City Mall

    September 16, 2022
    By admin1
  • Science & Tech

    Should Coca-Cola Park, Da Vinci Science Center Get ARPA Funding From Allentown? | | Lehigh Valley Regional News

    September 8, 2022
    By admin1
  • All

    7 Powerful Digital Marketing Strategies for Small Businesses

    March 28, 2022
    By admin1

You may interested

  • Science & Tech

    After a long wait, the Science Project opens | News

  • Science & Tech

    The Science Behind Why Your Dog Likes To Lick | Life

  • Science & Tech

    GSF Car Parts Black Friday Bonanza: Major Discounts on Premium Car Parts

Search

Categories

  • All (1,240)
  • Animal Food (18)
  • Books & Novels (18)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,702)
  • Fitness & Health (19)
  • Food & Drinks (16)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,590)
  • Health & Beauty (21)
  • Home&Living (217)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (8)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,346)
  • Sports (23)
  • Technology (155)
  • Travel & Lifestyle (14)
  • Travel & Lifestyle (1,641)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Scoprite il futuro dell’informatica con i portatili e le workstation ad alte prestazioni di HP

    By admin1
    June 15, 2025
  • Comprehensive Divorce Guides: How to Secure Your Financial Future During and After Divorce

    By admin1
    June 15, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • MU Health Care works with Siteman Cancer Center to prevent cancer

    By admin1
    September 26, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy