Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Step Into a World of Secrets, Spy Skills, Interactive Missions, and Mystery-Filled ...

      July 3, 2026
      0
    • Explore Flexible Online Learning, Healthy Ageing Support, and Expert-Led Courses with Learning ...

      July 2, 2026
      0
    • Build Practical Skills, Creative Confidence, and Everyday Knowledge with Expert-Led Courses at ...

      July 2, 2026
      0
    • Compare Travel Insurance with Ease and Find Smarter Cover Options for Every ...

      July 2, 2026
      0
    • Compare Travel Insurance and Everyday Costs with PayingTooMuch

      July 2, 2026
      0
    • Discover Boston from Above with 360° Views, Memorable Keepsakes, Sunset Moments, and ...

      July 1, 2026
      0
    • One World Observatory: Dining, Events, and Skyline Views Above New York City

      July 1, 2026
      0
    • Discover New York from Above with Unforgettable Views, Special Offers, and Sky-High ...

      July 1, 2026
      0
    • Discover Smarter Ferry Deals and Easy Sea Adventures with Ferryhopper

      July 1, 2026
      0
  • Fashion
    • Un marchio di bottiglie eleganti e sostenibili, pensato per l'idratazione quotidiana, l'espressione ...

      July 4, 2026
      0
    • Discover Stylish Polarised Sunglasses, Everyday Eye Comfort, and Clear Vision with Feel ...

      July 2, 2026
      0
    • Find Stylish Everyday Eyeglasses, Comfortable Frames, and Personal Eyewear Choices at Fytoo

      July 2, 2026
      0
    • Discover Bold Nike Sneakers, Football-Inspired Streetwear, and Unique Preloved Styles at Crepslocker

      July 2, 2026
      0
    • Stradivarius Sports Shorts: Easy Style for Casual Everyday Looks

      June 21, 2026
      0
    • Stradivarius Sports Sweatshirts: Casual Comfort with Fresh Everyday Style

      June 21, 2026
      0
    • Trova il modello ideale tra queste splendide opzioni di abiti moderni

      June 9, 2026
      0
    • Camicie moderne perfette, realizzate per l'uomo dinamico e attento allo stile

      June 9, 2026
      0
    • Scopri i migliori abiti firmati per lasciare il segno

      June 9, 2026
      0
  • Health & Beauty
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
    • Refresh Your Everyday Hygiene Routine with Gentle, Sustainable, and Easy-to-Use Care from ...

      July 1, 2026
      0
    • Farmasave Wellness Picks: cura della pelle, alimentazione e supporto per la salute ...

      June 30, 2026
      0
    • Erfahren Sie, warum Patienten GETCONG bei ihrem Bedarf an medizinischem Cannabis vertrauen

      June 16, 2026
      0
    • Schnelle und diskrete Lieferung von medizinischem Cannabis in ganz Deutschland

      June 16, 2026
      0
    • Moderne digitale Lösungen für den Zugang zu professioneller medizinischer Cannabisversorgung

      June 16, 2026
      0
    • Scopri gli integratori più apprezzati per uno stile di vita attivo e ...

      June 9, 2026
      0
    • Wybierz zapach, który naprawdę odzwierciedla Twoją osobowość

      June 9, 2026
      0
    • A Modern Hygiene Solution for Everyday Freshness, Comfort, and Confidence Wherever Life ...

      June 7, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Un marchio di bottiglie eleganti e sostenibili, pensato per l’idratazione quotidiana, l’espressione personale e uno stile di vita eco-sostenibile

  • Il tuo punto di riferimento online di fiducia per salute, bellezza e benessere

  • Step Into a World of Secrets, Spy Skills, Interactive Missions, and Mystery-Filled Discovery at SPYSCAPE

  • Celebrate a Fun West End Musical Night with Tickets, Souvenirs, and Theatre-Inspired Gifts from Book of Mormon London

  • Discover Stylish Polarised Sunglasses, Everyday Eye Comfort, and Clear Vision with Feel Good Contacts

  • Find Stylish Everyday Eyeglasses, Comfortable Frames, and Personal Eyewear Choices at Fytoo

  • Explore Flexible Online Learning, Healthy Ageing Support, and Expert-Led Courses with Learning with Experts

  • Build Practical Skills, Creative Confidence, and Everyday Knowledge with Expert-Led Courses at Learning with Experts

All
Home›All›NEPC trains Southeast Asian non-oil exporters in digital marketing

NEPC trains Southeast Asian non-oil exporters in digital marketing

By admin1
September 9, 2022
389
0
Share:

[ad_1]

1 of Nigeria Export Promotion Council (NEPC) says it has trained at least 50 non-oil exporters in the Southeast on digital marketing.

Nigerian newspapers read them online

2 Mrs. Salamatu Audi The Council’s Policy and Strategy Division said this during the Zone’s e-commerce training on Friday Enugu.

Nigerian newspapers read them online

3 Audi said the training is to help exporters effectively use the council’s e-commerce platform.

Nigerian newspapers read them online

Four She said the training was organized in collaboration with NEPC National Information Technology Development Agency (NITDA).

Five She said high volatility and a declining economy have made it expedient for exporters to boost their business through digital marketing.

6 According to Audi, digital marketing gives people the opportunity to access free online portals.

7 It also helps provide a platform for exporters to have a ‘domain name’ to sell their products.

8 “In the past, our exporters have not been able to put much effort into marketing their products due to distance and costs.

9 “To break down business barriers, you need to be tech savvy and have an online shop.

Ten ”
Audi said that under the digital age, physical stores are no longer enough to participate in the global market.

11 “So we are working together Nitta It’s for training small business operators,” she said.

12 She said the participants “are already reasonably building their capabilities in the global marketplace.”

13 She said she was given a free personal domain name where she would sell her products for a year.

14 Also, the Council’s Southeast Regional Coordinator, Mr. Arnold Jacksonsaid the training is to help participants showcase their products in the global market.

15 Jackson said e-commerce will revolutionize global trade and people won’t have to physically move before selling a product.

16 “We would like to open up our e-commerce platform to ensure that exporters in the zone can sell their products over the internet.

17 “In the current reality of the country, it is best to go digital, but certain parameters need to be set to be able to sell on that platform,” said Jackson.

18 Also, an employee of NEPC, Mr. Tony Orenroasaid non-oil exports had become the only viable means of survival for the country.

19 Olenloa said that as part of its services, NEPC has helped exporters compete globally.

20 NITDA representative Mr. Oguntade Adesaisays digital marketing has helped businesses create value for their customers and build strong customer relationships.

News source credit: naan

www bet9ja shop

[ad_2]

Source link

TagsbestbuildingBusinessfreefridaymarketingnewspeopleshopstrongTechthetrainingyou
Previous Article

ENTREPRENEUR UNIVERSE BRIGHT GROUP ANNOUNCES CHANGE OF ...

Next Article

TikTok unveils new programming and creative effects ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    This battered fashion stock could be the next big thing

    September 19, 2022
    By admin1
  • Science & Tech

    Allergy season will be affected by climate change, scientists say

    September 3, 2022
    By admin1
  • Health & Beauty

    Mike McDaniel says he wasn’t worried about Tua’s health before game

    September 30, 2022
    By admin1
  • Shein acquires stake in Forever 21

    August 24, 2023
    By admin1
  • Fashion

    Fashion Week is back in Pokémon GO.

    September 22, 2022
    By admin1
  • Science & Tech

    Emerald Coast Science Center weathers COVID pandemic and emerges stronger

    September 29, 2022
    By admin1

You may interested

  • Science & Tech

    Introducing the new Cortex magazine, a bridge between science and art

  • Science & Tech

    Klinger gains experience in medical laboratory science

  • Science & Tech

    Chinese and US scientists celebrate pioneering female physicist

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,747)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (19)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,614)
  • Health & Beauty (22)
  • Home&Living (232)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,345)
  • Sports (33)
  • Technology (183)
  • Travel & Lifestyle (1,724)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Un marchio di bottiglie eleganti e sostenibili, pensato per l’idratazione quotidiana, l’espressione personale e uno ...

    By techsmillion
    July 4, 2026
  • Il tuo punto di riferimento online di fiducia per salute, bellezza e benessere

    By techsmillion
    July 3, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Doja Cat ‘confirms’ romance with Stranger Things’ Joseph Quinn as they pack on the PDA ...

    By admin1
    August 18, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy