Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Unlock the Freedom to Explore New Cities at Your Own Pace with ...

      May 22, 2025
      0
    • TUI Cars - Zuverlässige globale Autovermietung für flexibles Reisen mit allem Drum ...

      May 22, 2025
      0
    • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

      May 18, 2025
      0
    • Travel in Style and Comfort with Europcar’s Wide Range of Premium Vehicles

      May 18, 2025
      0
    • From Business Trips to Scenic Escapes – Europcar Delivers Every Time

      May 18, 2025
      0
    • Experience Seamless Mobility Across Continents with Europcar’s Global Fleet

      May 18, 2025
      0
    • Unlock Limitless Travel Possibilities with Europcar’s Flexible Rental Solutions

      May 18, 2025
      0
    • Unwind in Style: Discover the Luxury and Charm of the QHotels Collection ...

      May 15, 2025
      0
    • Experience The Heart Of The City Through Cutting-Edge Interactive Technology

      May 15, 2025
      0
  • Fashion
    • L'ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

      May 18, 2025
      0
    • Erhöhen Sie Ihr Schuhspiel: Herren-Barfußstiefel von Groundies

      May 15, 2025
      0
    • Treten Sie ein in die Welt minimalistischer Barfußschuhe für ultimative Freiheit und ...

      May 15, 2025
      0
    • Luis Trenker Kleider: Entworfen für Frauen, die sich trauen, aufzufallen

      May 14, 2025
      0
    • Laufen bei jedem Wetter: Entdecken Sie die besten Laufjacken bei Laufbar

      May 14, 2025
      0
    • Laufen mit Komfort und Stil: Entdecken Sie die besten Laufschuhe bei Laufbar

      May 14, 2025
      0
    • Améliorez votre condition physique avec Myprotein : Les meilleures ventes de vêtements ...

      May 10, 2025
      0
    • Elevate Your Wardrobe with Fruugo: A Vast Selection of Women’s Shoes for ...

      May 8, 2025
      0
    • Enhance Your Golf Game and Style with Premium Men’s Headwear from Discount ...

      May 5, 2025
      0
  • Health & Beauty
    • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana - Bottega Verde: Bellezza naturale ...

      May 22, 2025
      0
    • L'ARISÉ Damenduftkollektion: Eleganz in jeder Note

      May 19, 2025
      0
    • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

      May 19, 2025
      0
    • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

      May 19, 2025
      0
    • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

      May 18, 2025
      0
    • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

      May 18, 2025
      0
    • Fitness Trifft Innovation: Die Speediance Revolution Beginnt Jetzt

      May 15, 2025
      0
    • Erleben Sie die Kraft natürlicher Inhaltsstoffe in den MiiN-Körpercremes

      May 15, 2025
      0
    • Vom Bauernhof zur Verpackung: Das Engagement von Lucky Hemp für hochwertige CBD-Blüten

      May 15, 2025
      0
  • Science & Tech
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
    • Revolution beim Kochen im Freien: Rüsten Sie sich mit Ration1.de Essentials

      December 23, 2024
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana – Bottega Verde: Bellezza naturale dalla Toscana

  • Unlock the Freedom to Explore New Cities at Your Own Pace with Convenient Vehicle Rentals

  • NINJA Küche Deutschland: Intelligente Geräte, die den Kochalltag verändern

  • TUI Cars – Zuverlässige globale Autovermietung für flexibles Reisen mit allem Drum und Dran

  • Die besten Porzellan-Geschirrkollektionen für alle, die Wert auf Design und Alltagstauglichkeit legen

  • Egret Elektro-Roller und Zubehör: Erhöhen Sie Ihre Fahrt mit Innovation und Stil

  • My Egret – Intelligente Mobilität mit Stil und Präzision neu definiert

  • L’ARISÉ Damenduftkollektion: Eleganz in jeder Note

All
Home›All›NEPC trains Southeast Asian non-oil exporters in digital marketing

NEPC trains Southeast Asian non-oil exporters in digital marketing

By admin1
September 9, 2022
232
0
Share:

[ad_1]

1 of Nigeria Export Promotion Council (NEPC) says it has trained at least 50 non-oil exporters in the Southeast on digital marketing.

Nigerian newspapers read them online

2 Mrs. Salamatu Audi The Council’s Policy and Strategy Division said this during the Zone’s e-commerce training on Friday Enugu.

Nigerian newspapers read them online

3 Audi said the training is to help exporters effectively use the council’s e-commerce platform.

Nigerian newspapers read them online

Four She said the training was organized in collaboration with NEPC National Information Technology Development Agency (NITDA).

Five She said high volatility and a declining economy have made it expedient for exporters to boost their business through digital marketing.

6 According to Audi, digital marketing gives people the opportunity to access free online portals.

7 It also helps provide a platform for exporters to have a ‘domain name’ to sell their products.

8 “In the past, our exporters have not been able to put much effort into marketing their products due to distance and costs.

9 “To break down business barriers, you need to be tech savvy and have an online shop.

Ten ”
Audi said that under the digital age, physical stores are no longer enough to participate in the global market.

11 “So we are working together Nitta It’s for training small business operators,” she said.

12 She said the participants “are already reasonably building their capabilities in the global marketplace.”

13 She said she was given a free personal domain name where she would sell her products for a year.

14 Also, the Council’s Southeast Regional Coordinator, Mr. Arnold Jacksonsaid the training is to help participants showcase their products in the global market.

15 Jackson said e-commerce will revolutionize global trade and people won’t have to physically move before selling a product.

16 “We would like to open up our e-commerce platform to ensure that exporters in the zone can sell their products over the internet.

17 “In the current reality of the country, it is best to go digital, but certain parameters need to be set to be able to sell on that platform,” said Jackson.

18 Also, an employee of NEPC, Mr. Tony Orenroasaid non-oil exports had become the only viable means of survival for the country.

19 Olenloa said that as part of its services, NEPC has helped exporters compete globally.

20 NITDA representative Mr. Oguntade Adesaisays digital marketing has helped businesses create value for their customers and build strong customer relationships.

News source credit: naan

www bet9ja shop

[ad_2]

Source link

TagsbestbuildingBusinessfreefridaymarketingnewspeopleshopstrongTechthetrainingyou
Previous Article

ENTREPRENEUR UNIVERSE BRIGHT GROUP ANNOUNCES CHANGE OF ...

Next Article

TikTok unveils new programming and creative effects ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    PUMA Metaverse Exclusive NFTS New York Fashion Week

    September 7, 2022
    By admin1
  • All

    How Fix My Curls Uses Digital Marketing Tools to Build Strong Communities

    September 27, 2022
    By admin1
  • Science & Tech

    Too few planners understand what special operators can do today

    May 5, 2024
    By admin1
  • Africa Climate Summit 2023: Climate Action Africa Takes Center Stage

    September 6, 2023
    By admin1
  • Fashion

    Paintings, fashion, NFTs – this window exhibit in Fort Worth’s Sundance Square has it all

    August 18, 2022
    By admin1
  • All

    Influencers can lead a horse to water and make it drink

    July 6, 2023
    By admin1

You may interested

  • Science & Tech

    College of St. Benedict Adds Data Science Major to St. John’s

  • Science & Tech

    Rockland Community College Launches Healthcare Science Program

  • Science & Tech

    Science Center, Epcot, and Legacy of Legoland – Orlando Sentinel

Search

Categories

  • All (1,238)
  • Animal Food (17)
  • Books & Novels (14)
  • Buying Guides (22)
  • Buying Guides (32)
  • Donation and Services (6)
  • Export Test (21)
  • Fashion (1,690)
  • Fitness & Health (17)
  • Food & Drinks (15)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,576)
  • Health & Beauty (20)
  • Home&Living (208)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (4)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,344)
  • Sports (21)
  • Technology (151)
  • Travel & Lifestyle (1,613)
  • Travel & Lifestyle (5)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Bottega Verde: Bellezza Naturale Artigianale dalla Toscana – Bottega Verde: Bellezza naturale dalla Toscana

    By admin1
    May 22, 2025
  • Unlock the Freedom to Explore New Cities at Your Own Pace with Convenient Vehicle Rentals

    By admin1
    May 22, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Aspirus provides mental health services to the Greater Wisconsin Rapids community.press room

    By admin1
    September 23, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy