Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys ...

      August 12, 2026
      0
    • Descubre Nueva York junto a otros en las visitas en grupo al ...

      August 11, 2026
      0
    • Au-dessus des lumières de la ville : des expériences inoubliables à l'One ...

      August 8, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

  • Erfrischen Sie sich, tanken Sie neue Energie und meistern Sie Ihren Tag mit dem Faxe Kondi Energy Booster

  • Discover the Best Ferry Deals and Special Offers for More Affordable Journeys with Ferryhopper

Health & Beauty
Home›Health & Beauty›NC Health News talks about new Medicaid program

NC Health News talks about new Medicaid program

By admin1
September 23, 2022
428
0
Share:

[ad_1]

Clarissa Donnelly-Deroben

With the Healthy Opportunities Pilot launched, how is your organization using the program to better serve your customers?

We discussed this topic with Sonya Jones, co-founder of Caja Solidaria. As of August 18, Caja Solidaria has her 47 referrals to her HOP program. Jones believes the program will benefit not only the health of his clients, but the health of his community as well.

Amy Upham also joined the conversation as executive director of the Eleanor Health Foundation. The foundation connects people with substance use disorders and other mental illnesses to affordable medicine, employment, and more.

The third panelist was Madlyn Morreale, a North Carolina Legal Aid Attorney. Legal Aid NC helps North Carolinians find housing resources, health care and more.

NC Health News Medicaid and local health reporter Clarissa Donnelly-DeRoven moderated the panel.

Republish articles online or in print for free under a Creative Commons license.

close the window X

republish this article

As of late 2019, we are changing our content reprint policy.

NC Health News content is free to use under the following conditions:

  • You can copy this HTML tracking code and paste it into your article. This small code snippet allows you to track how many people have read your article.




  • Please do not reprint articles without signatures. Include a live link to NC Health News under your byline like this:

    Jane Doe

    North Carolina Health News



  • Finally, at the end of your article (whether web or print), please include the following text:

    North Carolina Health News is an independent, nonpartisan, non-profit, statewide news organization covering all things health care in North Carolina. Visit NCHN at Northcarolinahealthnews.org. (On the web, this can be hyperlinked)

Clarissa Donnelly Deroben, North Carolina Health News
September 22, 2022

1

Clarissa Donnelly-DeRoven is responsible for rural health and Medicaid. She previously worked for the Asheville Citizen Times, reporting on police, courts, and other aspects of the criminal justice system.

[ad_2]

Source link

Tagscommunitycreativefollowingfreehealthhealthylivenewnewspeopletheyouyoutube
Previous Article

Phoenix Bishop Opens Up About Family History, ...

Next Article

Jay-Based School District Hires Another Special Education ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Home&Living

    Unleash Your Inner Chef with MÄNNKITCHEN: Essential Tools for Every Kitchen

    May 28, 2024
    By admin1
  • Fashion

    Deciphering Latin American fashion for India

    August 22, 2022
    By admin1
  • Science & Tech

    Science: How do we convince a flat earth that our planet is really round?Science and technology

    August 13, 2022
    By admin1
  • Fashion

    Today’s fashion trends are formed by a medley of influences. Here’s a look at emerging styles through the lens of ...

    September 16, 2022
    By admin1
  • Science & Tech

    Hurricane Andrew and climate science lessons – POLITICO

    August 26, 2022
    By admin1
  • All

    Denver SEO firm Get Found Fast offers custom digital marketing plans in Colorado

    September 20, 2022
    By admin1

You may interested

  • Science & Tech

    Russian cruise missiles have US Air Force scouting for thousands of acres of land

  • Science & Tech

    How California Schools Incorporate the Science of Reading and Phonics | Video

  • Science & Tech

    Biomedical, data science training wins new grant

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,345)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,752)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

    By techsmillion
    August 19, 2026
  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

    By techsmillion
    August 18, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Immerse Yourself in the Timeless Beauty of After the Rain

    By admin1
    December 4, 2024

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy