Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Health & Beauty
Home›Health & Beauty›Misconceptions about sunburn and its health effects

Misconceptions about sunburn and its health effects

By admin1
September 8, 2022
519
0
Share:

[ad_1]

A man sunbathing while lounging on an inflatable chair in his backyardShare on Pinterest
Experts say you should apply sunscreen whenever you’re exposed to the sun.Burton/Getty Images
  • A new survey shows that the majority of people believe tanning is healthy.
  • According to experts, sunburn is the body’s response to DNA damage caused by the sun.
  • They say that overexposure to the sun can lead to skin damage and skin cancer.
  • When outdoors, it is recommended to wear protective clothing such as sunscreen and hats.

The majority of Europeans, and people in other parts of the world, believe that tanning is both attractive and healthy.

The former is probably controversial, but dermatologists say the latter is dead wrong.

8 out of 10 Europeans find tanned skin attractive and 73% consider tanning to be ‘healthy’, according to findings presented at the 31st European Dermatological and Venereal Congress this week. It turns out that

Both beliefs were also common outside of Europe, including in the Americas, Africa, Oceania, and Asia. 59% believe tanning is healthy.

But Dr. Thomas Wang, director of the Department of Skin Oncology at Hogue Memorial Hospital Presbyterian Melanoma and Complex Skin Cancer Program in California, told Healthline that sunburn is the body’s protective response to DNA damage caused by the sun’s ultraviolet rays. He said that it was

“When you get a sunburn, there are signs that DNA damage has already occurred,” he said.

Somewhat counterintuitively, this study, conducted by the La Roche-Posay Institute and Ipsos, found that 92% of Europeans and 86% of non-Europeans are aware that sun exposure ages their skin. I was.

“If you’re not worried about skin cancer, keep in mind that sun exposure can speed up aging.

“About 90% of skin aging is caused by sun exposure,” says Angela, a dermatologist at the Ohio Associates Center for Surgical Dermatology and Dermatology and founder of youth skincare company Bright Girl. Dr. Casey told Healthline. “Applying sunscreen every day can help protect your skin from the damaging effects of the sun. Just like regular exercise and a healthy diet, consistent daily use of sunscreen can help keep your skin healthy. We can keep it strong.”

Most people, including 84% of Europeans and 79% of non-Europeans, say they do not protect themselves from the sun all year round.

In fact, researchers found that only 10% of Europeans and 14% of non-Europeans regularly use sunscreen, wear hats and protective clothing, and stay in shade year-round to avoid sun exposure. I discovered that I was trying to stay in

Casey pointed out that not only can the sun damage your skin in any season, but even UV rays that reflect off water, snow, and other bright surfaces can be harmful.

Other common misconceptions highlighted in the survey are that sunscreen protects the skin from burns and thus eliminates the need to apply sunscreen, and that sunscreen is not necessary if the weather is cloudy. was.

“Excess melanin in tanned skin can result in an SPF of 2 to 4, which is slightly better than no SPF at all,” says Casey. “However, SPF 2 to 4 is far from sufficient sun protection, and skin can easily get burned after short exposure to the sun with little sunscreen.”

“This study shows how the ‘healthy’ tanning myth persists, even in people who have already suffered sun damage or developed skin cancer,” said the study’s lead investigator. said principal investigator Dr. Thierry Passeron, professor and chairman of the university. The Department of Dermatology, University of the Côte d’Azur, Nice, France, said in a press release:

“The belief that tanning is healthy and attractive is a learned and deeply ingrained belief that likely began in the 1920s,” said Casey. In contrast, the wealthier upper classes were proud of their white skin and wore parasols to protect their skin from the sun outdoors. This idea changed in the 1920s, when fashion icon Coco Chanel, along with such prominent publications as Harper’s Bazaar and Vogue, used tanned skin to promote leisure, wealth, travel, and society. I started to associate it with status.”

A study found that even 72% of high-risk people, including those who had previously had skin cancer, consider tanning to be healthy. .

“My patients with a history of skin cancer are likely to spend more time in the sun compared to those without skin cancer. “We value recreational experiences, vacations, or jobs that allow us to be active,” Casey said. They associate tanning with important life events, which is why many have associated “tanning” with health, vitality, fun, leisure, productivity and well-being. ”

Such attitudes persist, Casey says, and change requires an incremental approach.

“My advice is to adopt atomic habits. Make small changes to your routine so that you can do it consistently,” she said. “For example, wear a hat when you’re outdoors at a sporting event. Put sunscreen next to your toothbrush. Don’t forget to brush your teeth. Focus on applying sunscreen as your face, scalp and ears are exposed to the sun most of the day.”

Experts emphasized that sunscreen needs to be reapplied every two hours for full protection, but half of the respondents who used sunscreen only used it once a day (and 10% said they never used sunscreen).

“Most people don’t apply enough sunscreen to achieve an SPF rating on a sunscreen product,” says Casey. “In fact, research shows that, in general, most of us only achieve half of his SPF rating on sunscreen products.”

The Society of Pediatric Dermatology offers the following sunscreen guidelines:

  • For younger children, ½ teaspoon for face and 1 oz for body.
  • For older children, teens and adults, at least 9 teaspoons total including 1 teaspoon for face and neck, 1 teaspoon for torso, 1 teaspoon for back, 1 teaspoon for each arm and 2 teaspoons for each leg Use a full teaspoon.

Experts say most sunscreens are only effective for 90 to 120 minutes.

It seems that the choice of sunscreen is also important. The Academy of Pediatric Dermatology recommends a broad-spectrum (blocks both UVA and UVB rays) sunscreen with SPF 30 or higher. Casey says that people with fair skin should use her SPF of 45 or higher.

Direct sunlight should be avoided during peak hours from 10am to 2pm. The American Academy of Dermatology recommends wearing protective clothing outdoors, such as a wide-brimmed hat, to protect your face, scalp, ears, and neck.

[ad_2]

Source link

Tagscaliforniadailydaydietfashionfrancefungirlhealthhealthylifemynewniceskincaresnowtravelwaterwhiteworld
Previous Article

Ancient ‘dragons’ were the first gliding reptiles ...

Next Article

Free classes for teen mental health first ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • All

    How Lawyers Use Digital Marketing to Generate Qualified Leads

    June 10, 2022
    By admin1
  • Fashion

    Kate Spade New York and Harlem’s Fashion Row to Partner at 2022 HBCU Fashion Summit, First of Tapestry, Inc.’s Multi-Year ...

    September 27, 2022
    By admin1
  • Technology

    Unleash Unmatched Power with BLUETTI’s Expandable Energy Stations

    October 8, 2024
    By admin1
  • All

    How to do digital marketing in the age of privacy

    May 20, 2022
    By admin1
  • Travel & Lifestyle

    UAE Education Market to Record CAGR 5.03%, Growing Awareness of Early Education Becomes Key Trend

    September 21, 2022
    By admin1
  • Science & Tech

    4 books that got me hooked on science

    August 29, 2022
    By admin1

You may interested

  • Science & Tech

    Space Force wants ‘sustained’ satellite mobility by 2028

  • Science & Tech

    Webb telescope builder is ‘questioning science so far’

  • Science & Tech

    Morgan Hill Author’s New Science Book Explores ‘Evolution of Life’ – Morgan Hill Times

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Köstlich nahrhaft: Entdecken Sie Protein Cookies bei MyProtein

    By admin1
    February 5, 2025

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy