Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Science & Tech
Home›Science & Tech›Imre Adds Two Life Science Industry Veterans to Strengthen Wellness Practices

Imre Adds Two Life Science Industry Veterans to Strengthen Wellness Practices

By admin1
August 31, 2022
494
0
Share:

[ad_1]

Christine Wobshall When Sonal Adhab Enhancing the customer experience for agencies, medical practice

New York, August 31, 2022 /PRNewswire/ — Imre Continuing Commitment to Life Sciences Excellence Introduces Two Industry Veterans Christine WobshallVice President of Client Experience, Sonal Adhab, Senior Director of Medical Affairs. The two of them are part of an effort that continues to shape agency best practices in the areas of client experience and healthcare strategy.

Imre Adds Two Life Science Industry Veterans to Strengthen Wellness Practices

Imre Adds Two Life Science Industry Veterans to Strengthen Wellness Practices

Kristine brings over 15 years of experience in the pharmaceutical and medical device industry to imre’s Client Experience practice. In this promoted role, Kristine will be responsible for customer relationship management and the overall business health of her portfolio, leveraging her strong digital background and omnichannel strategy to solve customer challenges. Use your passion. Kristine has extensive experience on both the brand and agency side, including FCB Health and her GSW. Most recently, she served as Vice President and Managing Director of H4B Chelsea, where she was responsible for strategy, campaign development and launch of her AOR relationships with leading brands in the rare disease, HIV, oncology and women’s health therapeutic areas. led the

What is essential to solidify imre’s medical strategy is Sonal Adhab A veteran of medical communications who joined imre after 20 years of experience in medical education, pharmaceutical advertising and science strategy. Sonal recently held a leadership role in medcomms at Fishawack Health and has extensive experience in therapeutic areas such as immuno-oncology (prostate/hematological/non-melanoma skin cancer) and rheumatoid arthritis.

“Our healthcare business is expanding rapidly and we continue to invest in top talent to meet the needs of our clients. Anna Kotis, president of imre Health. “We were very lucky to find both Sonal and Christine. They are high impact leaders who seamlessly joined us in their work and made us even stronger. I am very happy to welcome you.”

About Imre:

Imre works with many of the world’s leading high-growth brands. Driven by innovation, the agency’s integrated suite of marketing communications services includes brand strategy, creative, digital marketing, social media, public relations and media, and data and analytics. Imre partners with a diverse and growing portfolio of brands including Amgen, AstraZeneca, Bausch & Lomb, GlaxoSmithKline and PTC Therapeutics.agency maintains office New York, Los Angeles, baltimore When Philadelphia Additionally, there is a growing group of employees working from anywhere. Imre He is an LGBTQ founded company.

SOURCE Imre

[ad_2]

Source link

TagsbestbrandBusinesscreativeeducationhappyhealthlifemarketingnewpassionstrongthetopwellnesswomenworkworldyou
Previous Article

The best women’s fall fashion at Nordstrom ...

Next Article

Taliban officials say Islam gives women the ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Fashion

    Ferrari presents third fashion show at Milan Fashion Week

    September 26, 2022
    By admin1
  • Health & Beauty

    New abortion laws jeopardize cancer treatment for pregnant patients

    September 24, 2022
    By admin1
  • Health & Beauty

    Eagles WR struggled after Giants benched him: ‘I was just eating to wash the pain away’

    July 28, 2024
    By admin1
  • Health & Beauty

    6 Ways Prenatal Ultrasound Impacts Health and/or Care

    September 3, 2022
    By admin1
  • Health & Beauty

    Stress-Free Living: The Power of CBD for Mental Health

    October 3, 2024
    By admin1
  • Travel & Lifestyle

    How I Used Basketball to Help Black Boys Embrace Emotional Wellness

    June 12, 2024
    By admin1

You may interested

  • Science & Tech

    Iowa Science Center Won’t Reopen Imax Theaters

  • Science & Tech

    Scientists may have identified neurons that produce fear : ScienceAlert

  • Science & Tech

    Political Science Professor’s Book on Islamic Law Wins Two International Research Association Awards | News | Department of Political Science

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • 2023 World’s Ugliest Dog Winner: Scooter, the Chinese Crested Puppy, Crowned in Annual Contest

    By admin1
    June 27, 2023

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy