Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

      May 18, 2025
      0
    • Travel in Style and Comfort with Europcar’s Wide Range of Premium Vehicles

      May 18, 2025
      0
    • From Business Trips to Scenic Escapes – Europcar Delivers Every Time

      May 18, 2025
      0
    • Experience Seamless Mobility Across Continents with Europcar’s Global Fleet

      May 18, 2025
      0
    • Unlock Limitless Travel Possibilities with Europcar’s Flexible Rental Solutions

      May 18, 2025
      0
    • Unwind in Style: Discover the Luxury and Charm of the QHotels Collection ...

      May 15, 2025
      0
    • Experience The Heart Of The City Through Cutting-Edge Interactive Technology

      May 15, 2025
      0
    • Enjoy Seamless Luxury and Excitement at Caesars Rewards Most Prestigious Vegas Locations

      May 15, 2025
      0
    • Discover Top Campgrounds Near Iconic National Parks for the Ultimate Outdoor Adventure

      May 11, 2025
      0
  • Fashion
    • Explore Casetify’s Durable and Customizable iPhone 16 Pro Max Cases

      May 19, 2025
      0
    • L'ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

      May 18, 2025
      0
    • Erhöhen Sie Ihr Schuhspiel: Herren-Barfußstiefel von Groundies

      May 15, 2025
      0
    • Treten Sie ein in die Welt minimalistischer Barfußschuhe für ultimative Freiheit und ...

      May 15, 2025
      0
    • Luis Trenker Kleider: Entworfen für Frauen, die sich trauen, aufzufallen

      May 14, 2025
      0
    • Laufen bei jedem Wetter: Entdecken Sie die besten Laufjacken bei Laufbar

      May 14, 2025
      0
    • Laufen mit Komfort und Stil: Entdecken Sie die besten Laufschuhe bei Laufbar

      May 14, 2025
      0
    • Améliorez votre condition physique avec Myprotein : Les meilleures ventes de vêtements ...

      May 10, 2025
      0
    • Elevate Your Wardrobe with Fruugo: A Vast Selection of Women’s Shoes for ...

      May 8, 2025
      0
  • Health & Beauty
    • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

      May 19, 2025
      0
    • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

      May 19, 2025
      0
    • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

      May 18, 2025
      0
    • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

      May 18, 2025
      0
    • Fitness Trifft Innovation: Die Speediance Revolution Beginnt Jetzt

      May 15, 2025
      0
    • Erleben Sie die Kraft natürlicher Inhaltsstoffe in den MiiN-Körpercremes

      May 15, 2025
      0
    • Vom Bauernhof zur Verpackung: Das Engagement von Lucky Hemp für hochwertige CBD-Blüten

      May 15, 2025
      0
    • Verbessern Sie Ihre Hautpflege mit den Premium-Gesichtsseren von MiiN

      May 15, 2025
      0
    • Unlock Superior Health Benefits with Zooki Liposomal Supplements: Advanced Absorption for Maximum ...

      May 15, 2025
      0
  • Science & Tech
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
    • Die 5 besten Hörgeräte von KIND: Innovation, Präzision und erstklassiger Service

      January 1, 2025
      0
    • Revolution beim Kochen im Freien: Rüsten Sie sich mit Ration1.de Essentials

      December 23, 2024
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

  • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

  • Explore Casetify’s Durable and Customizable iPhone 16 Pro Max Cases

  • Camif : Solutions de mobilier durable pour des espaces de vie élégants et fonctionnels

  • Unforgettable Weddings Await: Celebrate Your Special Day at QHotels’ Stunning Venues

  • Die Forever Young-Reihe: Intelligente Nahrungsergänzungsmittel für modernes Wohlbefinden

  • Forever Young Power Cans: Komplettes Protein für tägliche Kraft

  • L’ARISÉ: Zeitlose Eleganz trifft auf erschwinglichen Luxus in jedem Duft

Science & Tech
Home›Science & Tech›Imre Adds Two Life Science Industry Veterans to Strengthen Wellness Practices

Imre Adds Two Life Science Industry Veterans to Strengthen Wellness Practices

By admin1
August 31, 2022
283
0
Share:

[ad_1]

Christine Wobshall When Sonal Adhab Enhancing the customer experience for agencies, medical practice

New York, August 31, 2022 /PRNewswire/ — Imre Continuing Commitment to Life Sciences Excellence Introduces Two Industry Veterans Christine WobshallVice President of Client Experience, Sonal Adhab, Senior Director of Medical Affairs. The two of them are part of an effort that continues to shape agency best practices in the areas of client experience and healthcare strategy.

Imre Adds Two Life Science Industry Veterans to Strengthen Wellness Practices

Imre Adds Two Life Science Industry Veterans to Strengthen Wellness Practices

Kristine brings over 15 years of experience in the pharmaceutical and medical device industry to imre’s Client Experience practice. In this promoted role, Kristine will be responsible for customer relationship management and the overall business health of her portfolio, leveraging her strong digital background and omnichannel strategy to solve customer challenges. Use your passion. Kristine has extensive experience on both the brand and agency side, including FCB Health and her GSW. Most recently, she served as Vice President and Managing Director of H4B Chelsea, where she was responsible for strategy, campaign development and launch of her AOR relationships with leading brands in the rare disease, HIV, oncology and women’s health therapeutic areas. led the

What is essential to solidify imre’s medical strategy is Sonal Adhab A veteran of medical communications who joined imre after 20 years of experience in medical education, pharmaceutical advertising and science strategy. Sonal recently held a leadership role in medcomms at Fishawack Health and has extensive experience in therapeutic areas such as immuno-oncology (prostate/hematological/non-melanoma skin cancer) and rheumatoid arthritis.

“Our healthcare business is expanding rapidly and we continue to invest in top talent to meet the needs of our clients. Anna Kotis, president of imre Health. “We were very lucky to find both Sonal and Christine. They are high impact leaders who seamlessly joined us in their work and made us even stronger. I am very happy to welcome you.”

About Imre:

Imre works with many of the world’s leading high-growth brands. Driven by innovation, the agency’s integrated suite of marketing communications services includes brand strategy, creative, digital marketing, social media, public relations and media, and data and analytics. Imre partners with a diverse and growing portfolio of brands including Amgen, AstraZeneca, Bausch & Lomb, GlaxoSmithKline and PTC Therapeutics.agency maintains office New York, Los Angeles, baltimore When Philadelphia Additionally, there is a growing group of employees working from anywhere. Imre He is an LGBTQ founded company.

SOURCE Imre

[ad_2]

Source link

TagsbestbrandBusinesscreativeeducationhappyhealthlifemarketingnewpassionstrongthetopwellnesswomenworkworldyou
Previous Article

The best women’s fall fashion at Nordstrom ...

Next Article

Taliban officials say Islam gives women the ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    Unlock Your Best Skin: The Magic of The Ordinary Serums

    December 4, 2024
    By admin1
  • Health & Beauty

    Dear Abby: ‘My mother keeps reminding me of all the mistakes I’ve made,’ says recovering alcoholic

    September 14, 2023
    By admin1
  • Health & Beauty

    MAGNITONE: The Ultimate Solution for Radiant and Healthy Skin Through Advanced Technology

    December 30, 2024
    By admin1
  • Fashion

    Hudson Bay Revives Zellers, Announces More Fashion News

    August 20, 2022
    By admin1
  • Travel & Lifestyle

    Higher Education Servicing Corporation Announces Launch of HESC Solutions, Inc.

    August 31, 2022
    By admin1
  • All

    Louth’s company, Sixtwo Digital, helps raise €20 million for charity

    September 29, 2022
    By admin1

You may interested

  • Science & Tech

    US plans to publish government-funded scientific research papers • The Register

  • Science & Tech

    Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

  • Science & Tech

    Today’s D Brief: Sweden’s PM to the WH; Erdogan still blocking NATO expansion; Israel buys more F-35s; State’s Afghan withdrawal review; And a bit more.

Search

Categories

  • All (1,238)
  • Animal Food (17)
  • Books & Novels (14)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (6)
  • Export Test (21)
  • Fashion (1,691)
  • Fitness & Health (17)
  • Food & Drinks (15)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,574)
  • Health & Beauty (20)
  • Home&Living (206)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (3)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,344)
  • Sports (21)
  • Technology (149)
  • Travel & Lifestyle (5)
  • Travel & Lifestyle (1,609)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Capalus Energy Drinks: Kraft, Konzentration und Erfrischung mit jedem Schluck

    By admin1
    May 19, 2025
  • Steigern Sie Ihre Leistung mit Capalus Sports Nutrition

    By admin1
    May 19, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Digital marketing firm announces £1.5m profit

    By admin1
    August 24, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy