Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Fashion
Home›Fashion›Fashion: 90s and Y2K Fashion Reimagined | Bakersfield Life

Fashion: 90s and Y2K Fashion Reimagined | Bakersfield Life

By admin1
August 27, 2022
450
0
Share:

[ad_1]

It finally happened. I’m old enough to see childhood trends revived and reimagined.The ’90s and Y2K have some edgy styles with relaxed, funky silhouettes and vibrant colors. There was, but the other style was an absolute disaster and should never go back.

Seeing these styles come back made me want to try them again with a more sophisticated mindset. Because I know what I like, what works best for my body type, and I’ve learned a few tips and tricks from years of fashion school and working in the fashion industry. .

Below are the trends that I currently employ that are “bombshells” and those that say “as if.”

“Bomb” category

barbie core: This trend centers around a feminine wardrobe in hot pinks styled from head to toe.Think Paris Hilton and Nicole Richie in the early 2000s. Style the trend with a hot pink satin power suit with pearls and pumps.

Coastal Grandmother: This trend started in the 2000s and is based on beachside minimalist style. The best way to imagine this style is to think of Diane Keaton’s wardrobe in the movie Something’s Gotta Give. I love this trend because it’s effortlessly chic and comfortable. I recently purchased a cream knit collared top and knit tan shorts, paired them with bronze Birkenstocks to embrace my inner coastal granny.

Bell bottom jeans: Excited to see this silhouette return. In addition to looking great on some body types, this style is more comfortable than skinny jeans. I like to wear bellbottoms with classic fitted tees.

Hair claw: The 90’s were full of all kinds of hair accessories, including hair claws. Fast forward to 2022 and the Hair Claw is back, and it comes in different patterns and different materials. I wear white plastic hair nails around the house and pearl-encrusted metal nails when I go out.

“As if” Category

Mini skirt: Alicia Silverstone featured many plaid miniskirts in 1995’s “Clueless,” making every girl want to rock a miniskirt. The trend is cute, but since I’m in my 30s, I think a longer length would suit me better, so I’ll leave that up to high school students.

Low rise jeans: Frankly, I didn’t like this trend because it felt unsophisticated.

Butterfly clip: As I mentioned earlier, the 90’s were full of hair accessories such as comb hair bands, scrunchies, metal snaps, hair ragami, butterfly clips, etc. I’ve had hundreds since I was a kid. I like this trend, but I think it should be reserved for children.

Preppy style: Ralph Lauren made preppy style iconic in the ’90s, especially with his colorful polos. Instead of a polo paired with a knotted cardigan, I opt out and go for the classic Princess Diana white button-up.

Becca Bland is the marketing director for the Daejeon outlet. She has a Bachelor of Science in Business from the Institute of Design and Merchandising and has extensive experience in the fashion world including Elle PR and designers such as Citizens of Humanity and Ted Baker. Her brands include .

[ad_2]

Source link

TagsBusinesscolorfulcolorscutedesignfashiongirlhairlifelovemarketingmemynailsparispinkstyletrendwhiteworld
Previous Article

This former SFCC computer science professor worked ...

Next Article

Education | News, Sports, Jobs

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    ZERO TO THREE Receives $5 Million Award from U.S. Department of Health and Human Services to Strengthen Infant Court Program

    September 2, 2022
    By admin1
  • Fashion

    10 very fashionable cowboy boot outfits

    September 2, 2022
    By admin1
  • Travel & Lifestyle

    Fierce Nevada gubernatorial race brings Republican challenger Lombardo into education

    September 17, 2022
    By admin1
  • Fashion

    Kim Kardashian at the Dolce & Gabbana fashion show: photo

    September 24, 2022
    By admin1
  • Health & Beauty

    Valley News – Dozens of Dartmouth health workers being shifted to Texas-based billing firm

    September 25, 2022
    By admin1
  • Home&Living

    Luxuriöse Catering-Möbel von LUSINI: Die perfekte Ergänzung für jede Veranstaltung

    September 16, 2024
    By admin1

You may interested

  • Science & Tech

    Celebrate Science in Indiana This Weekend to Encourage the Importance of Learning Science and the Joy of Discovery – WISH-TV | Indianapolis News | Indiana Weather

  • Science & Tech

    Shaq rides LeBron James, Lakers need

  • Science & Tech

    Taiwan is using generative AI to fight Chinese disinfo

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,622)
  • Health & Beauty (22)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • University of Alabama Celebrates Fashion Facility at Drummond Lyon Hall

    By admin1
    September 20, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy