Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

All
Home›All›Digital Marketing Seminar for SMEs

Digital Marketing Seminar for SMEs

By admin1
August 3, 2022
405
0
Share:

[ad_1]

digital marketing

Digital marketing should be a top priority for your business, but we all know that navigating all the different tactics, figuring out what works for your business, and changing trends isn’t easy.

Hosted by Keuka College, this seminar provides insightful and powerful knowledge on digital marketing strategies for small business owners and employees. Please bring a laptop/device with access to your Google and social media accounts as this seminar is hands-on.

Some important topics covered:

  • Google My Business
  • social media tactics
  • Best practices for paid/boosted posts
Pete Bekis

Keuka College’s Vice President of Enrollment and Marketing, Pete Bekisz, will be the afternoon presentation speaker. He is an active community volunteer and serves on the boards of Finger Lakes Safe Harbors and the Finger Lakes Workforce Investment Board. Additionally, through the Young Entrepreneurs Academy, he volunteers as a mentor to his teenage entrepreneurs in the Rochester area. Prior to Keuka College, he held positions at AOL Time Warner, Messenger Post Media, and Ignite Worldwide Inc. He has provided consulting services to the Greater Rochester Association of Realtors, Kenneth Crosby Companies, and Kate Gleason College of Engineering at Rochester Institute. Many small businesses in technology, and in Finger Lakes.

A light afternoon snack is provided. Stay and attend the YCCC Business After Hours that follow this event.

Register at https://business.yatesny.com/events/details/growth-series-digital-marketing-for-small-businesses-5552

The Growth Series program is sponsored by Lyons National Bank and Keuka College.

If you go:

what: Digital marketing for small business

when: August 10 (Wednesday) 3:00 pm to 5:00 pm

Where: Keuka College (Room 133) at Keuka Commons

register: $20 for Yates County Chamber of Commerce members, $30 for non-Chamber members. Growth Series – Digital Marketing for Small Businesses requires pre-registration by Friday, August 5th.

[ad_2]

Source link

TagsBusinesscommunitydetailseventfollowfridaylightmarketingmythetimetopyou
Previous Article

Digital Marketing Analyst – Axios Charlotte

Next Article

Crossword PR Acquires Digital Marketing Assignments for ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Buying GuidesBuying GuidesFashionGift GuidesGift Guides

    The View fans left divided by MAJOR changes to ABC daytime show as Whoopi Goldberg and cohosts return for a ...

    September 3, 2024
    By admin1
  • Health & Beauty

    Health Equity: The Current Environment and Paths to Improvement

    September 26, 2022
    By admin1
  • Science & Tech

    The back of the napkin cafe opens in the Center for Engineering and Computer Science

    September 20, 2022
    By admin1
  • Science & Tech

    Do dragons exist? These reptiles come closer.

    August 26, 2022
    By admin1
  • Science & Tech

    Scott Hollifield: Now for the latest science news | Columnist

    August 21, 2022
    By admin1
  • Fashion

    How will the Queen’s death affect London Fashion Week?

    September 11, 2022
    By admin1

You may interested

  • Science & Tech

    How California Schools Incorporate the Science of Reading and Phonics | Video

  • Science & Tech

    Remote job options for the life sciences industry

  • Science & Tech

    Why paint looks different in different lighting

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • The ‘Barbie’ Movie “Anti-Man” Backlash Is Wrong

    By admin1
    July 26, 2023

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy