Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Entdecken Sie die Freude am nahtlosen Reisen: Die Kraft von Deutschlandticket entfalten

      July 10, 2025
      0
    • Wählen Sie die beste Fähre für Ihre nächste Reise: Starten Sie in ...

      July 10, 2025
      0
    • The QHotels Collection – Elegant Escapes, Golf Retreats, and Relaxed Luxury Stays ...

      July 9, 2025
      0
    • Erkunden Sie Europas atemberaubendste Städte bequem und entspannt bei Ihrem nächsten Städtetrip

      July 9, 2025
      0
    • Caesars Rewards – The Ultimate Destination for Gaming, Luxury, and World-Class Hospitality

      July 9, 2025
      0
    • Discover Xcaret: Where Nature, Culture, and Adventure Come to Life

      July 9, 2025
      0
    • One World Observatory: Rise Above, See Beyond, Feel New York Like Never ...

      July 9, 2025
      0
    • Unveiling the Post Office: Unlocking a World of Convenience and Services

      July 9, 2025
      0
    • Direkt vom Bildschirm – Memmo liefert unvergessliche Momente

      June 25, 2025
      0
  • Fashion
    • Empowerment Starts Underneath: The EBY Revolution in Comfort and Purpose

      July 9, 2025
      0
    • Shop Ethical Fashion and Vintage Finds to Support Global Causes While Elevating ...

      July 9, 2025
      0
    • Wear the Change – Explore Comfort and Purpose with EBY Intimates

      June 26, 2025
      0
    • Seamless Confidence – Redefining Everyday Comfort with EBY Intimates

      June 20, 2025
      0
    • Stylish Finds for Little Ones: Shop Pre-Loved Kids' Dresses with Purpose

      June 13, 2025
      0
    • Jeden Kilometer meistern: Laufbar Laufjacke für Herren – Unübertroffener Komfort, Stil und ...

      June 10, 2025
      0
    • Scopri profumi femminili di lusso per ogni stato d'animo e occasione

      June 6, 2025
      0
    • Shop Smart, Dress Sharp: Ethical Superstore Men’s Shirts for a Stylish and ...

      June 4, 2025
      0
    • Transform Your Wardrobe with the Unmatched Style of Dresses from WAT THE ...

      June 4, 2025
      0
  • Health & Beauty
    • Choose the Right Fragrance for You: Top Perfumes That Define Femininity and ...

      July 9, 2025
      0
    • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

      June 12, 2025
      0
    • Verwandeln Sie Ihr Haar mit MiiN Cosmetics: Die ultimative Revolution in der ...

      June 11, 2025
      0
    • Verbessern Sie Ihre Wellness-Routine mit Lucky Hemp CBD Ölen

      June 11, 2025
      0
    • L'ARISÉ Beauty: Entdecken Sie den Reiz von pudriger Eleganz und zeitloser Raffinesse ...

      June 9, 2025
      0
    • Scopri i prodotti delicati per la cura dei capelli e per ottenere ...

      June 8, 2025
      0
    • Trasforma la tua pelle con questi prodotti idratanti essenziali – Sconti speciali

      June 6, 2025
      0
    • Le migliori soluzioni per la cura della pelle: protezione solare e sollievo ...

      June 6, 2025
      0
    • Experience Enhanced Wellness with Zooki’s Cutting-Edge Liquid Supplements Designed for Maximum Effectiveness

      June 6, 2025
      0
  • Science & Tech
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Drive Smart, Travel Far – Discover Flexible, Eco-Friendly Car Hire with Europcar Worldwide

  • Europcar – Reliable Car Rentals With Flexible Plans and Hidden Fee Risks

  • Entdecken Sie die Freude am nahtlosen Reisen: Die Kraft von Deutschlandticket entfalten

  • Wählen Sie die beste Fähre für Ihre nächste Reise: Starten Sie in Ihr nächstes Abenteuer mit den unvergesslichen Fährreisen von DFDS

  • Stampa come un professionista: libera prestazioni intelligenti e senza interruzioni con le stampanti HP

  • Step-by-Step Strategy for Successful Real Estate Transactions in California’s Competitive Market

  • The QHotels Collection – Elegant Escapes, Golf Retreats, and Relaxed Luxury Stays Across Iconic UK Destinations

  • Erkunden Sie Europas atemberaubendste Städte bequem und entspannt bei Ihrem nächsten Städtetrip

All
Home›All›Digital Marketing Seminar for SMEs

Digital Marketing Seminar for SMEs

By admin1
August 3, 2022
257
0
Share:

[ad_1]

digital marketing

Digital marketing should be a top priority for your business, but we all know that navigating all the different tactics, figuring out what works for your business, and changing trends isn’t easy.

Hosted by Keuka College, this seminar provides insightful and powerful knowledge on digital marketing strategies for small business owners and employees. Please bring a laptop/device with access to your Google and social media accounts as this seminar is hands-on.

Some important topics covered:

  • Google My Business
  • social media tactics
  • Best practices for paid/boosted posts
Pete Bekis

Keuka College’s Vice President of Enrollment and Marketing, Pete Bekisz, will be the afternoon presentation speaker. He is an active community volunteer and serves on the boards of Finger Lakes Safe Harbors and the Finger Lakes Workforce Investment Board. Additionally, through the Young Entrepreneurs Academy, he volunteers as a mentor to his teenage entrepreneurs in the Rochester area. Prior to Keuka College, he held positions at AOL Time Warner, Messenger Post Media, and Ignite Worldwide Inc. He has provided consulting services to the Greater Rochester Association of Realtors, Kenneth Crosby Companies, and Kate Gleason College of Engineering at Rochester Institute. Many small businesses in technology, and in Finger Lakes.

A light afternoon snack is provided. Stay and attend the YCCC Business After Hours that follow this event.

Register at https://business.yatesny.com/events/details/growth-series-digital-marketing-for-small-businesses-5552

The Growth Series program is sponsored by Lyons National Bank and Keuka College.

If you go:

what: Digital marketing for small business

when: August 10 (Wednesday) 3:00 pm to 5:00 pm

Where: Keuka College (Room 133) at Keuka Commons

register: $20 for Yates County Chamber of Commerce members, $30 for non-Chamber members. Growth Series – Digital Marketing for Small Businesses requires pre-registration by Friday, August 5th.

[ad_2]

Source link

TagsBusinesscommunitydetailseventfollowfridaylightmarketingmythetimetopyou
Previous Article

Digital Marketing Analyst – Axios Charlotte

Next Article

The newsletter boom has died down but ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    The science behind local forecasts by the KSAT Weather Authority team

    September 30, 2022
    By admin1
  • All

    Domino Records – Junior Digital Marketing Manager (UK)

    September 12, 2022
    By admin1
  • Science & Tech

    Army looks to de-tangle its networks to combat China’s ‘digitally native’ military

    August 16, 2023
    By admin1
  • Science & Tech

    Academics Bring Science to the Green Man Festival

    September 20, 2022
    By admin1
  • Science & Tech

    Science Cafe returns to Nashua

    September 12, 2022
    By admin1
  • Travel & Lifestyle

    Council approves $1.2 million BOE request from education tax – Andalusia Star News

    August 20, 2022
    By admin1

You may interested

  • Science & Tech

    What role should industry play in military space operations? The Space Force is working on a strategy for that.

  • Science & Tech

    Runway Growth Capital Joins Life Sciences Team with New Dallas Managing Director » Dallas Innovates

  • Science & Tech

    Keith: Faith, Science, Phases of Venus

Search

Categories

  • All (1,240)
  • Animal Food (19)
  • Books & Novels (21)
  • Buying Guides (32)
  • Buying Guides (22)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,710)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (16)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (21)
  • Health & Beauty (1,591)
  • Home&Living (218)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (10)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,346)
  • Science & Tech (1)
  • Sports (23)
  • Technology (157)
  • Travel & Lifestyle (1,651)
  • Travel & Lifestyle (14)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Drive Smart, Travel Far – Discover Flexible, Eco-Friendly Car Hire with Europcar Worldwide

    By admin1
    July 10, 2025
  • Europcar – Reliable Car Rentals With Flexible Plans and Hidden Fee Risks

    By admin1
    July 10, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Dear Abby: Wife who says husband is desperate for women’s attention would cheat if he ...

    By admin1
    December 20, 2023

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy