Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ultimate Adventure and Sensory Exploration at Xcaret: Your Gateway to Riviera Maya’s ...

      June 13, 2025
      0
    • Thrill Unleashed – Curated Adventure Gifts for the Daring, Bold, and Wild ...

      June 12, 2025
      0
    • Explore New Roads in Comfort and Style with Europcar’s Flexible Vehicle Rental ...

      June 10, 2025
      0
    • The QHotels Collection – Luxury Escapes, Spa Breaks, and Golf Retreats Across ...

      June 10, 2025
      0
    • Caesars Unleashed – Luxury, Luck, and Legendary Escapes Await

      June 9, 2025
      0
    • Europcar Offers the Ultimate Travel Flexibility with a Wide Range of Reliable ...

      June 7, 2025
      0
    • Explore the Best Travel Insurance Options for Every Journey and Travel Type ...

      June 7, 2025
      0
    • Unlocking the Future of Longevity and Healthy Aging with Audiobooks

      June 6, 2025
      0
    • Effortless Car Rental: Making Travel More Convenient and Enjoyable

      June 6, 2025
      0
  • Fashion
    • Stylish Finds for Little Ones: Shop Pre-Loved Kids' Dresses with Purpose

      June 13, 2025
      0
    • Jeden Kilometer meistern: Laufbar Laufjacke für Herren – Unübertroffener Komfort, Stil und ...

      June 10, 2025
      0
    • Scopri profumi femminili di lusso per ogni stato d'animo e occasione

      June 6, 2025
      0
    • Shop Smart, Dress Sharp: Ethical Superstore Men’s Shirts for a Stylish and ...

      June 4, 2025
      0
    • Transform Your Wardrobe with the Unmatched Style of Dresses from WAT THE ...

      June 4, 2025
      0
    • Versatile Dresses for Every Occasion: Sustainable Fashion at Its Best

      June 4, 2025
      0
    • Explore the Best Men’s Shirts for Sustainable Travel and Style

      June 4, 2025
      0
    • Transform Your Daily Look with These Luxe Loungewear Must-Haves

      June 4, 2025
      0
    • Timeless Denim and Relaxed Fits: Discovering WAT THE BRAND’s Essentials

      June 3, 2025
      0
  • Health & Beauty
    • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

      June 12, 2025
      0
    • Verwandeln Sie Ihr Haar mit MiiN Cosmetics: Die ultimative Revolution in der ...

      June 11, 2025
      0
    • Verbessern Sie Ihre Wellness-Routine mit Lucky Hemp CBD Ölen

      June 11, 2025
      0
    • L'ARISÉ Beauty: Entdecken Sie den Reiz von pudriger Eleganz und zeitloser Raffinesse ...

      June 9, 2025
      0
    • Scopri i prodotti delicati per la cura dei capelli e per ottenere ...

      June 8, 2025
      0
    • Trasforma la tua pelle con questi prodotti idratanti essenziali – Sconti speciali

      June 6, 2025
      0
    • Le migliori soluzioni per la cura della pelle: protezione solare e sollievo ...

      June 6, 2025
      0
    • Experience Enhanced Wellness with Zooki’s Cutting-Edge Liquid Supplements Designed for Maximum Effectiveness

      June 6, 2025
      0
    • Satisfy Your Nut Butter Cravings with MyProtein’s Pure, No-Additive Spreads

      June 3, 2025
      0
  • Science & Tech
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
    • Alla scoperta dell'Universo con l'Istituto Stellare Comprendere i misteri del Cosmo

      January 9, 2025
      0
  • Gift Guides
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Waterford Crystal – Timeless Beauty and Artistry in Luxury Glassware and Home ...

      January 28, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Scoprite il futuro dell’informatica con i portatili e le workstation ad alte prestazioni di HP

  • Comprehensive Divorce Guides: How to Secure Your Financial Future During and After Divorce

  • Shop with Purpose: Oxfam’s Creative & Impactful Products

  • Ultimate Adventure and Sensory Exploration at Xcaret: Your Gateway to Riviera Maya’s Best Parks

  • Stylish Finds for Little Ones: Shop Pre-Loved Kids’ Dresses with Purpose

  • Verbessern Sie die Gesundheit Ihres Pferdes mit den natürlichen Premium-Nahrungsergänzungen von EQUIVA

  • Fuel Your Workout with MyProtein’s Protein Powders: Amazing Offers Inside

  • Audible Experience Redefined – Audiobooks, Podcasts, and Endless Stories

All
Home›All›Caribbean Digital Platform Offers Labor Day Deals

Caribbean Digital Platform Offers Labor Day Deals

By admin1
September 2, 2022
249
0
Share:

[ad_1]

News Fort Lauderdale, Florida, USA, Friday. September 2, 2022: Hard Beat Communications, an award-winning Caribbean-owned digital PR and AD agency, gives any organization the digital marketing tools they need to grow their business from one dashboard with the click of a mouse We launched our own digital platform. A fraction of the cost of other digital agencies.

And this Labor Day weekend, businesses of all sizes can get started with their own dashboard and 8 free digital marketing software tools for a small subscription fee of US$30 per month. Social media platforms at once. Option to manage client meetings in one place. Software that manages reviews from a dashboard. The means to manage your brand’s digital growth and ensure your company is listed accurately across search engines, and the option to view and manage your clients on custom brand dashboards, including invoicing.

Digital Dashboard from Heartbeat
Hard Beat Digital Products.

Hard Beat also offers many other tools that you can add to grow your company’s brand through digital marketing.

A social media pro tool that allows you to manage and schedule social posts across multiple platforms.

Option to organically grow company listings on hundreds of sites. Tools for managing reviews and posting 5-star reviews on your site.

Option to let every team member get their own custom meeting link using a calendar software tool.

SEO for you

Create, manage, import and host websites including landing pages and e-commerce sites.

Design and create social media pages.

Content creation including blogging, website content, social media content and management, press release writing and global distribution.

Digital advertising purchases, including geofencing, and digital marketing consulting.

Brand design for flyers, powerpoint presentations, brochures, business cards and more.

with custom branded office videos;

Cybersecurity testing and malware removal.

Founded in 2004 by Caribbean immigrant Felicia J. Persaud and now part of the ICN Group of Companies, Hard Beat has gone fully digital since the pandemic, launching a dynamic digital platform to Grow at any scale through digital marketing without huge monthly maintenance and service fees.

“Unlike traditional AD and PR agencies, we offer every client at least $50 to grow digitally on the Heartbeat platform, with a unique dashboard to add services as we grow. It gives us the opportunity to operate like a large company,” said Persaud. “This takes a lot of the pressure off without a big upfront budget or the guesswork of digital marketing. You can see it in real time, as much or less than what they want to put in.”

Subscribe now or learn more on hardbeatcommunications.com or on social media (Facebook.com/hardbeatcommunications, Twitter). @hardbeatcomms or linked at linkedin.com/in/hardbeatcommunications



[ad_2]

Source link

TagsbrandBusinesscustomdaydesignfacebookfloridafreefridaymarketingnewsteamthetimetraditionalusaviewweekendwritingyou
Previous Article

Smithsonian Folkways – Digital Marketing & Distribution ...

Next Article

Learn to be an astronaut with space ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    Mental Health & Addiction Awareness Event | Celent News, Sports & Jobs

    August 26, 2022
    By admin1
  • Health & Beauty

    Buy Haleon stock. This GSK spinoff is a bargain for consumer health.

    August 18, 2022
    By admin1
  • Science & Tech

    As irregular warfare comes to a crossroads, Congress chips in

    December 17, 2023
    By admin1
  • Health & Beauty

    Watch National Health Center Week | News, Sports, Jobs

    August 15, 2022
    By admin1
  • Health & Beauty

    Midlife Health and Menopause Center

    August 24, 2022
    By admin1
  • Fashion

    North West Is a Fashion Critic, Just Look to Her Met Gala 2023 Review

    November 24, 2023
    By admin1

You may interested

  • Science & Tech

    For Adams, mandatory vaccines for New York City workers is about compliance, not science (opinion)

  • Science & Tech

    UT Computer Science Students Share Internships and Program Struggles – The Daily Texan

  • Science & Tech

    Prince Charles is an ardent supporter of pseudoscience

Search

Categories

  • All (1,240)
  • Animal Food (18)
  • Books & Novels (18)
  • Buying Guides (22)
  • Buying Guides (32)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,702)
  • Fitness & Health (19)
  • Food & Drinks (16)
  • Gift Guides (24)
  • Gift Guides (52)
  • Health & Beauty (1,590)
  • Health & Beauty (21)
  • Home&Living (217)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (8)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1)
  • Science & Tech (1,346)
  • Sports (23)
  • Technology (155)
  • Travel & Lifestyle (1,641)
  • Travel & Lifestyle (14)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Scoprite il futuro dell’informatica con i portatili e le workstation ad alte prestazioni di HP

    By admin1
    June 15, 2025
  • Comprehensive Divorce Guides: How to Secure Your Financial Future During and After Divorce

    By admin1
    June 15, 2025
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Transforming Education in Uncertain Times: Insights on Afghanistan

    By admin1
    September 16, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy