Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

      August 19, 2026
      0
    • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

      August 19, 2026
      0
    • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

      August 19, 2026
      0
    • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

      August 18, 2026
      0
    • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de ...

      August 18, 2026
      0
    • Discover the UK with Relaxing Park & Tour Breaks

      August 17, 2026
      0
    • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

      August 17, 2026
      0
    • POC Mountain Bike Helmets: Protection, Comfort & Performance

      August 16, 2026
      0
    • Un'assicurazione di viaggio affidabile per una vacanza all'estero senza preoccupazioni

      August 14, 2026
      0
  • Fashion
    • Odkryj stylowe damskie szorty dżinsowe w Volcano

      August 11, 2026
      0
    • UKSoccershop Football Hoodies – Wear Your Team Colours with Pride

      August 10, 2026
      0
    • Achieve a Stunning Transformation with Cliphair Jet Black Hair Extensions

      August 6, 2026
      0
    • The Complete Guide to Cliphair Hair Extensions and Professional Aftercare

      August 5, 2026
      0
    • Completa il tuo look con le borse da donna FK Official

      August 4, 2026
      0
    • Discover Stylish Men's Sunglasses That Combine Fashion, Comfort and UV Protection

      August 3, 2026
      0
    • Discover Premium Designer Jeans for Every Style, Fit, and Occasion

      August 3, 2026
      0
    • S.T. Dupont Taschen: Zeitloser französischer Luxus und raffinierter Stil

      July 11, 2026
      0
    • Γυναικεία μπλούζες και μπλούζες Stradivarius: Ανεπιτήδευτο στυλ για κάθε εποχή

      July 10, 2026
      0
  • Health & Beauty
    • Scopri la tua fragranza distintiva: profumi per ogni stile e occasione

      August 11, 2026
      0
    • Hume Health App: Intelligentere Erkenntnisse für einen gesünderen Lebensstil

      August 11, 2026
      0
    • Mantieni i tuoi capelli freschi ed equilibrati con lo shampoo giusto

      August 11, 2026
      0
    • Wype: The Smarter, Cleaner and Greener Way to Upgrade Your Everyday Hygiene ...

      August 8, 2026
      0
    • Ein Leitfaden zur Auswahl der besten Öle für Ihre kulinarischen Kreationen

      July 11, 2026
      0
    • Entdecken Sie intensive Feuchtigkeitspflege und strahlende Haut mit den Hautpflegeprodukten von Kiehl’s

      July 10, 2026
      0
    • Shampoo: il segreto per capelli sani, forti e luminosi

      July 10, 2026
      0
    • Zumub Protein Bars: A Delicious Way to Support Your Active Lifestyle

      July 7, 2026
      0
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

  • Experience the Magic of Summer 2026 at Warner Bros. Studio Tour Tokyo

  • Goditi un soggiorno prolungato all’insegna del comfort presso The Social Hub

  • Fit2Trip: un producto sólido, una diferenciación clara y un amplio margen de mejora

  • Discover the UK with Relaxing Park & Tour Breaks

  • Discover Relaxing Seaside Breaks and Coastal Getaways Across the UK with UKBreakaways

  • POC Mountain Bike Helmets: Protection, Comfort & Performance

Travel & Lifestyle
Home›Travel & Lifestyle›Candidates, Advocates Call for Change at Educational Rally

Candidates, Advocates Call for Change at Educational Rally

By admin1
September 17, 2022
451
0
Share:

[ad_1]

Kenneth Song / News Press Photo
Goleta Union School District Board Trustee Area Lee listens as newly elected Tuolumne County Superintendent Zach Abernathy listens at the “Rally for Education” event at Aijian Ranch in Santa Barbara on Friday. candidate Christy Lozano speaks.

Well over 100 attendees gathered at Santa Barbara’s Aijian Ranch on Friday to interact with local and statewide education candidates and discuss the perceived need for new directions in education county and California-wide. I was.

“We’re gathering school board members and candidates, so we’re here for an educational rally,” said event sponsor Christy Lozano, who is running for the Goleta Union District School Board Trustee Area Three in News. -Told the Press. “We just want to bring the entire state and the entire county together because building a very strong team and a very vibrant group of people can make a difference in education.”

Among the topics discussed by the event’s speakers and attendees were the teachers union’s efforts to overcome COVID-era restrictions in schools, increase levels of parental involvement in education, and focus more on students and learning outcomes. There was a need to control power.

Attendees react to speakers at events. More than 100 people attended the rally.

Santa Barbara City College Trustee Area 1 candidate Devi Stoker was one of 14 Santa Barbara County education candidates in attendance, where she spoke to News about the need to fully reopen SBCC to in-person learning. I spoke to the press.

“Today, I hope to shed some light on everyone trying to change school boards and school district boards and call attention to what’s still going on at Santa Barbara City College,” said Mrs. Stoker. Told. “For SBCC to keep unvaccinated students out of our classrooms, campuses, programs, and everything Santa Barbara has to offer, we need to really change that and put students first,” she said.

“Our neighbors at Allan Hancock Community College to the north are open and so are our friends to the south at Ventura City College. , should be welcomed back with open arms,” ​​she continued.

California Public Health Officer Dr. Thomas Aragon is revoking state-mandated vaccination requirements for K-12 employees effective Sept. 17. However, SBCC still requires vaccine verification for in-person attendance. Vaccine mandates for community colleges in California were never enacted at the statewide level, leaving the decision up to individual campuses.

Also present was Lance Christensen, an advocate for school choice policy and parental rights in education. He is one of his two nonpartisan candidates vying to be elected California superintendent of education this November.

“Now our children are destined based on their zip code. They go to schools randomly assigned based on where they live, not what their parents choose.” ‘ said Christensen in a statement. “California ranks 50th in the nation for literacy. , Mississippi is much better (than California). Of all states, this is the only state to improve literacy in the last two years. ”

“I think it’s time to really ‘come to Christ’ about our education system,” he continued. “Not just learning loss, but there are years of learning loss that children have had to deal with, such as rising suicide rates, anxiety and depression. It is a burden that we bear.”

One of the messages repeated throughout the event was that like-minded candidates need to step up and work together to put a common message in front of voters this November.

“I am very excited to meet all the people who have stepped forward at the local and state level to turn things around as a team,” she said in her remarks. Now is not the time to do things the old fashioned way, it’s the time to do things the smart way.”

Email: jdaniels@newspress.com

[ad_2]

Source link

Tagscaliforniacityeducationfocusfridayfriendshealthlightlivenewnewspeoplerunningschoolsongstrongthetimetodaywork
Previous Article

Art meets science in the analysis of ...

Next Article

Milan Travel Guide — Where to Eat, ...

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Health & Beauty

    See all homes sold in Linden, August 7 to August 13

    August 16, 2023
    By admin1
  • All

    3 Ways Growth Partners Can Drive Digital Engagement Initiatives

    September 12, 2022
    By admin1
  • Health & Beauty

    Dear Abby: Insensitive comments push mom toward plastic surgery

    September 1, 2023
    By admin1
  • Health & Beauty

    Dear Abby: Woman thinks her health issues have ruined her husband’s life

    November 6, 2023
    By admin1
  • Fashion

    Princess Diana turned this jewelry accident into a fashion statement

    September 4, 2022
    By admin1
  • Science & Tech

    Small, caterpillar-soft robot folds, rolls, grabs and takes apart — ScienceDaily

    September 15, 2022
    By admin1

You may interested

  • Science & Tech

    University of Utah Announces New Climate Science Policy Center with $20 Million Endowment

  • Science & Tech

    ‘Better and fairer future’: program advances diversity and materials science

  • Science & Tech

    Army considers new tool to track soldier readiness

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,762)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (22)
  • Gift Guides (52)
  • Gift Guides (23)
  • Health & Beauty (22)
  • Health & Beauty (1,622)
  • Home&Living (233)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (186)
  • Travel & Lifestyle (1,755)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Ferryhopper: Your Easy Way to Plan and Book Ferry Trips

    By techsmillion
    August 19, 2026
  • AXA Schermo Totale: copertura completa per il tuo prossimo viaggio

    By techsmillion
    August 19, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • The West End Health Foundation will award $30,000 to youth mental health programs around the ...

    By admin1
    September 2, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy