Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Enrichissez votre expérience de lecture grâce à ces grands magazines français

      May 20, 2026
      0
    • Beyond the Clouds: Why This is NYC’s Most Immersive Experience

      May 14, 2026
      0
    • Entdecken Sie die besten Fantasy-Hörbücher für Kinder – voller Staunen und Hoffnung

      May 14, 2026
      0
    • Solve, Move, Win: The Nostalgic Thrill of the Classic Board

      May 14, 2026
      0
    • Beyond the Skyline: Discovering Boston’s Soul from 750 Feet

      May 14, 2026
      0
    • Découvrez le pouvoir du son à travers ces cinq récits à ne ...

      May 14, 2026
      0
    • Scopri i piani sanitari Premium per famiglie per la massima tranquillità a ...

      May 14, 2026
      0
    • Affordable Travel Protection Quotes for Your Next Global Vacation

      May 14, 2026
      0
    • Entdecken Sie preisgekrönte Kunsthotels und Boutique-Unterkünfte in Norwegen

      May 14, 2026
      0
  • Fashion
    • Rinnova il tuo guardaroba quotidiano con questi splendidi abiti midi di Pull&Bear

      May 14, 2026
      0
    • Capo essenziale dalla vestibilità squadrata e di qualità eccellente per una moda ...

      May 14, 2026
      0
    • Scopri la nuova collezione stagionale di top in cotone firmati

      May 14, 2026
      0
    • Premium Oversized Streetwear Shirts Featuring Bold High Definition Prints

      May 14, 2026
      0
    • Απαραίτητες μοντέρνες τσάντες ώμου για μια τέλεια κομψή καλοκαιρινή εμφάνιση

      May 14, 2026
      0
    • CREPSLOCKER: Your Ultimate Destination for Exclusive Sneakers and Streetwear

      May 1, 2026
      0
    • La guida dell'uomo moderno per padroneggiare il look casual perfetto

      April 28, 2026
      0
    • I cinque look in denim indispensabili per ogni guardaroba in questa stagione

      April 24, 2026
      0
    • Best Lightweight Football Shirts from Spain’s Most Passionate Clubs

      April 23, 2026
      0
  • Health & Beauty
    • Capsule di glicinato di magnesio puro per alleviare lo stress e garantire ...

      May 14, 2026
      0
    • Modern Hygiene Made Simple with Wype

      May 12, 2026
      0
    • GETKONG: Naadloze digitale gezondheidszorg binnen handbereik

      May 6, 2026
      0
    • GETKONG: Directe gezondheidszorg, overal en altijd

      May 6, 2026
      0
    • GETKONG: Geef je levensstijl een nieuwe impuls met mode en innovatie

      May 6, 2026
      0
    • GETKONG: Jouw weg naar welzijn, prestaties en een gezonder leven

      May 6, 2026
      0
    • Wype: Smarter Hygiene Solutions for a Cleaner and Easier Lifestyle

      April 23, 2026
      0
    • PetenKoiratarvike: Premium-Lemmikkiruokaa ja Hoitoa Jokaiselle Karvaiselle Ystävälle

      October 9, 2025
      0
    • Transform Your Skin with Dermstore’s Premium Vitamin C Serums

      September 18, 2025
      0
  • Science & Tech
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
    • Transformieren Sie Ihr Unternehmen Mit Sage: Effizienz In Höchstform

      January 31, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Enrichissez votre expérience de lecture grâce à ces grands magazines français

  • Scopri mobili belli e resistenti per ogni spazio esterno

  • Znajdź idealne opony do swojego samochodu w iParts

  • Everything You Need to Know About Specialized Travel Insurance Plans

  • Transforma tu cocina casera con estos hornos profesionales Balay

  • Ottimizza i tuoi costi energetici con le nuove soluzioni energetiche di E.ON

  • Najlepsze naturalne przekąski poprawiające codzienne samopoczucie Twojego psa

  • Inside the World of Espionage: The SPYSCAPE Experience

All
Home›All›Arjun Gupta: Youngest serial entrepreneur with impeccable business skills

Arjun Gupta: Youngest serial entrepreneur with impeccable business skills

By admin1
August 20, 2022
420
0
Share:

[ad_1]

India’s business, entrepreneurship and industry-related spheres are digitally evolving and continue to advance using the latest internet technologies and artificial intelligence. Arjun Gupta is a young entrepreneur working in his field of digital marketing and advertising. He is the founder of AN Group International, a digital marketing and brand his solutions company. Arjun Gupta is known for having clients of international and national celebrities, brands and artists who rely on him to grow digitally and expand their brands in the online space.what connected Arjun Gupta How to become the youngest serial entrepreneur in India? read.

Ever since Arjun was in school, curiosity and inquisitiveness have been one of his dominant traits. He was drawn to the Internet and the way new businesses took advantage of it to grow exponentially. After several freelance projects, Arjun Gupta found out what he wanted to do in life: become an expert in his digital marketing.

He founded his own company known as AN Group International and started working on online projects, digital marketing assignments and social media management. About his early days in the digital marketing field, Arjun Gupta said: It will be the foundation for all future efforts. I had to work long hours to acquire my skill set and reach the standards I set for myself. ”

AN Group International, Arjun Gupta’s company of excellence, specializes in IT-based solutions, social media handling, e-commerce development, digital marketing, online advertising, press publication (PR), search engine optimization, websites and applications. We provide all kinds of digital services, such as the development of

As of today, Arjun’s company has surpassed one million in terms of sales and revenue. Thanks to his great knowledge and expertise in the digital realm, Arjun works with high-end clients and big spending brands internationally and domestically. A factor in Arjun Gupta’s achievements in the country’s digital and entrepreneurial sector is the quality and efficiency of the work he delivers. The results he produces are a testament to the fact that he never returns to his commitments.

The youngest serial entrepreneur, Arjun Gupta, is a promising name in the country’s digital marketing domain. He excels in the online space and has some very valuable possessions. The client is satisfied and would like to collaborate with him again.

like this:

favorite Now loading…

Related



[ad_2]

Source link

TagsbrandBusinessentrepreneurfacebookindialifemarketingmymyselfnewschoolthetodaywork
Previous Article

How are Pakistani supermodels and bloggers influencing ...

Next Article

EHRs don’t reduce costs for rural hospitals

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Science & Tech

    An adult-only night devoted to dinosaurs

    August 15, 2022
    By admin1
  • Health & Beauty

    UK health officials warn of difficult winter with flu and COVID

    September 27, 2022
    By admin1
  • Travel & Lifestyle

    Partner of Education Foundation and Sarasota Military Academy

    August 29, 2022
    By admin1
  • Travel & Lifestyle

    Eagle County Wild West Fundraising Education Foundation Returns Sunday

    September 23, 2022
    By admin1
  • Fashion

    The Grandmacore Aesthetic Trend Perpetuates Ageism

    October 18, 2023
    By admin1
  • Science & Tech

    Capito and Manchin Announce $4.7 Million in National Science Foundation Grants

    September 21, 2022
    By admin1

You may interested

  • Science & Tech

    Breakthrough in Fusion Energy?Major announcements to expect from US scientists

  • Science & Tech

    Pumpkin Spice (and All Great Stuff): We Love It Because There’s Brain Science Behind It

  • Science & Tech

    Auburn University Dedicates Tony and Riveraine Culinary Science Center

Search

Categories

  • All (1,241)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (21)
  • Buying Guides (31)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,733)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (17)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (1,602)
  • Health & Beauty (22)
  • Home&Living (227)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,344)
  • Science & Tech (1)
  • Sports (30)
  • Technology (172)
  • Travel & Lifestyle (1,691)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Enrichissez votre expérience de lecture grâce à ces grands magazines français

    By techsmillion
    May 20, 2026
  • Scopri mobili belli e resistenti per ogni spazio esterno

    By techsmillion
    May 20, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • Online play, fashion, and hair take center stage in Splatoon 3

    By admin1
    August 24, 2022

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy