Goevry World Shopping Magazine

Top Menu

  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

Main Menu

  • Travel & Lifestyle
  • Fashion
  • Health & Beauty
  • Science & Tech
  • Gift Guides
  • Buying Guides
  • DMCA
  • Privacy Policy
  • Contacts
  • UK
  • DE

logo

Goevry World Shopping Magazine

  • Travel & Lifestyle
    • Step Into a World of Secrets, Spy Skills, Interactive Missions, and Mystery-Filled ...

      July 3, 2026
      0
    • Explore Flexible Online Learning, Healthy Ageing Support, and Expert-Led Courses with Learning ...

      July 2, 2026
      0
    • Build Practical Skills, Creative Confidence, and Everyday Knowledge with Expert-Led Courses at ...

      July 2, 2026
      0
    • Compare Travel Insurance with Ease and Find Smarter Cover Options for Every ...

      July 2, 2026
      0
    • Compare Travel Insurance and Everyday Costs with PayingTooMuch

      July 2, 2026
      0
    • Discover Boston from Above with 360° Views, Memorable Keepsakes, Sunset Moments, and ...

      July 1, 2026
      0
    • One World Observatory: Dining, Events, and Skyline Views Above New York City

      July 1, 2026
      0
    • Discover New York from Above with Unforgettable Views, Special Offers, and Sky-High ...

      July 1, 2026
      0
    • Discover Smarter Ferry Deals and Easy Sea Adventures with Ferryhopper

      July 1, 2026
      0
  • Fashion
    • Un marchio di bottiglie eleganti e sostenibili, pensato per l'idratazione quotidiana, l'espressione ...

      July 4, 2026
      0
    • Discover Stylish Polarised Sunglasses, Everyday Eye Comfort, and Clear Vision with Feel ...

      July 2, 2026
      0
    • Find Stylish Everyday Eyeglasses, Comfortable Frames, and Personal Eyewear Choices at Fytoo

      July 2, 2026
      0
    • Discover Bold Nike Sneakers, Football-Inspired Streetwear, and Unique Preloved Styles at Crepslocker

      July 2, 2026
      0
    • Stradivarius Sports Shorts: Easy Style for Casual Everyday Looks

      June 21, 2026
      0
    • Stradivarius Sports Sweatshirts: Casual Comfort with Fresh Everyday Style

      June 21, 2026
      0
    • Trova il modello ideale tra queste splendide opzioni di abiti moderni

      June 9, 2026
      0
    • Camicie moderne perfette, realizzate per l'uomo dinamico e attento allo stile

      June 9, 2026
      0
    • Scopri i migliori abiti firmati per lasciare il segno

      June 9, 2026
      0
  • Health & Beauty
    • Il tuo punto di riferimento online di fiducia per salute, bellezza e ...

      July 3, 2026
      0
    • Refresh Your Everyday Hygiene Routine with Gentle, Sustainable, and Easy-to-Use Care from ...

      July 1, 2026
      0
    • Farmasave Wellness Picks: cura della pelle, alimentazione e supporto per la salute ...

      June 30, 2026
      0
    • Erfahren Sie, warum Patienten GETCONG bei ihrem Bedarf an medizinischem Cannabis vertrauen

      June 16, 2026
      0
    • Schnelle und diskrete Lieferung von medizinischem Cannabis in ganz Deutschland

      June 16, 2026
      0
    • Moderne digitale Lösungen für den Zugang zu professioneller medizinischer Cannabisversorgung

      June 16, 2026
      0
    • Scopri gli integratori più apprezzati per uno stile di vita attivo e ...

      June 9, 2026
      0
    • Wybierz zapach, który naprawdę odzwierciedla Twoją osobowość

      June 9, 2026
      0
    • A Modern Hygiene Solution for Everyday Freshness, Comfort, and Confidence Wherever Life ...

      June 7, 2026
      0
  • Science & Tech
    • Step Into the World of Secrets, Challenges, and Spy-Inspired Discovery with SPYSCAPE

      July 1, 2026
      0
    • Inside the World of Espionage: The SPYSCAPE Experience

      May 14, 2026
      0
    • Scoprite il futuro dell'informatica con i portatili e le workstation ad alte ...

      June 15, 2025
      0
    • Entdecken Sie die Innovation hinter Ninja-Geräten: Revolutionieren Sie Ihre Küche noch heute

      June 2, 2025
      0
    • Unleash Your Imagination: Explore Science Fiction & Fantasy Audiobooks with Audible

      March 12, 2025
      0
    • Apple MacBook Air bei WIRKAUFENS - Clevere Angebote, Top-Qualität und ultimative Leistung!

      March 1, 2025
      0
    • AGM-Batterien bei ATP Autoteile - Kraft, Leistung und Zuverlässigkeit für Ihr Fahrzeug!

      February 26, 2025
      0
    • Crush Your Hiring Test with JobTestPrep – Your Gateway to Career Success

      February 25, 2025
      0
    • Master Every Job Assessment with JobTestPrep Comprehensive Practice Tests and Expert Study ...

      February 19, 2025
      0
  • Gift Guides
    • A Social Night Out in London: Monopoly Lifesized Brings Competition to ...

      April 16, 2026
      0
    • Create Lasting Memories with CEWE Photo Book: Your Personalized Keepsake from Boots ...

      May 8, 2025
      0
    • Farrar & Tanner: Luxury and Bespoke Gifts for Every Occasion

      March 25, 2025
      0
    • Tommee Tippee Soothers: The Perfect Blend of Comfort, Style, and Practicality for ...

      March 13, 2025
      0
    • Indulge at the Pinnacle of Private Luxury with Je Joue

      March 8, 2025
      0
    • Get Closer to Your Favorite Stars With Memmo.me’s Exclusive Celebrity Video Messages

      February 25, 2025
      0
    • Waterford Crystal – Mastering the Art of Fine Glassware and Elegant Home ...

      February 15, 2025
      0
    • Discover the World of Exclusive Whiskies with The Scotch Malt Whisky Society

      February 8, 2025
      0
    • Embark on an Exclusive Whisky Journey with The Scotch Malt Whisky Society

      February 8, 2025
      0
  • Buying Guides
    • Elevate Your Game with Premium Golf Balls and Exclusive Deals at Discount ...

      April 17, 2025
      0
    • Aatu’s Premium Dog and Cat Food Delivers High-Quality Nutrition with Natural Ingredients

      April 14, 2025
      0
    • AATU Offers Premium Pet Food Made with Fresh Meat and Natural Ingredients ...

      April 9, 2025
      0
    • Discover the Best Boxsets from Townsendmusic

      February 21, 2025
      0
    • Transform Your Garden into a Bird Haven with These Must-Haves

      January 10, 2025
      0
    • Discovering Unique Whisky Flavours: A Journey of Taste and Tradition

      January 10, 2025
      0
    • Stress-Free Parenting Explore Tommee Tippee’s Range of Baby Care Innovations

      December 26, 2024
      0
    • TOMMEE TIPPEE Innovative Designs for Happy, Healthy Babies and Stress-Free Parents

      December 12, 2024
      0
    • Intelligent einkaufen: Der ultimative Preisvergleich für die besten Deals

      December 11, 2024
      0
  • Un marchio di bottiglie eleganti e sostenibili, pensato per l’idratazione quotidiana, l’espressione personale e uno stile di vita eco-sostenibile

  • Il tuo punto di riferimento online di fiducia per salute, bellezza e benessere

  • Step Into a World of Secrets, Spy Skills, Interactive Missions, and Mystery-Filled Discovery at SPYSCAPE

  • Celebrate a Fun West End Musical Night with Tickets, Souvenirs, and Theatre-Inspired Gifts from Book of Mormon London

  • Discover Stylish Polarised Sunglasses, Everyday Eye Comfort, and Clear Vision with Feel Good Contacts

  • Find Stylish Everyday Eyeglasses, Comfortable Frames, and Personal Eyewear Choices at Fytoo

  • Explore Flexible Online Learning, Healthy Ageing Support, and Expert-Led Courses with Learning with Experts

  • Build Practical Skills, Creative Confidence, and Everyday Knowledge with Expert-Led Courses at Learning with Experts

All
Home›All›Arjun Gupta: Youngest serial entrepreneur with impeccable business skills

Arjun Gupta: Youngest serial entrepreneur with impeccable business skills

By admin1
August 20, 2022
441
0
Share:

[ad_1]

India’s business, entrepreneurship and industry-related spheres are digitally evolving and continue to advance using the latest internet technologies and artificial intelligence. Arjun Gupta is a young entrepreneur working in his field of digital marketing and advertising. He is the founder of AN Group International, a digital marketing and brand his solutions company. Arjun Gupta is known for having clients of international and national celebrities, brands and artists who rely on him to grow digitally and expand their brands in the online space.what connected Arjun Gupta How to become the youngest serial entrepreneur in India? read.

Ever since Arjun was in school, curiosity and inquisitiveness have been one of his dominant traits. He was drawn to the Internet and the way new businesses took advantage of it to grow exponentially. After several freelance projects, Arjun Gupta found out what he wanted to do in life: become an expert in his digital marketing.

He founded his own company known as AN Group International and started working on online projects, digital marketing assignments and social media management. About his early days in the digital marketing field, Arjun Gupta said: It will be the foundation for all future efforts. I had to work long hours to acquire my skill set and reach the standards I set for myself. ”

AN Group International, Arjun Gupta’s company of excellence, specializes in IT-based solutions, social media handling, e-commerce development, digital marketing, online advertising, press publication (PR), search engine optimization, websites and applications. We provide all kinds of digital services, such as the development of

As of today, Arjun’s company has surpassed one million in terms of sales and revenue. Thanks to his great knowledge and expertise in the digital realm, Arjun works with high-end clients and big spending brands internationally and domestically. A factor in Arjun Gupta’s achievements in the country’s digital and entrepreneurial sector is the quality and efficiency of the work he delivers. The results he produces are a testament to the fact that he never returns to his commitments.

The youngest serial entrepreneur, Arjun Gupta, is a promising name in the country’s digital marketing domain. He excels in the online space and has some very valuable possessions. The client is satisfied and would like to collaborate with him again.

like this:

favorite Now loading…

Related



[ad_2]

Source link

TagsbrandBusinessentrepreneurfacebookindialifemarketingmymyselfnewschoolthetodaywork
Previous Article

How are Pakistani supermodels and bloggers influencing ...

Next Article

EHRs don’t reduce costs for rural hospitals

0
Shares
  • 0
  • +
  • 0
  • 0
  • 0

Related articles More from author

  • Travel & Lifestyle

    In a new course from the ChildCare Education Institute,

    August 25, 2022
    By admin1
  • Travel & Lifestyle

    Kris-Tech Hosts Hungry for Education Event

    August 20, 2022
    By admin1
  • Travel & Lifestyle

    Housing Hope Employment and Education Program Receives $130,000 Grant from Boeing

    August 20, 2022
    By admin1
  • All

    Highwire Public Relations Secures Strategic Investment from Shamrock Capital to Expand Capabilities and Accelerate Growth

    September 15, 2022
    By admin1
  • Fashion

    Mushroom Fashion Celebrates NYFW Moment at Stella McCartney’s Soho Store – WWD

    September 15, 2022
    By admin1
  • Fashion

    Mesh flats are the new face of impractical footwear

    July 4, 2023
    By admin1

You may interested

  • Science & Tech

    Church unites behind climate science – Chicago Tribune

  • Science & Tech

    Pope to Papal Academy: ‘Science is a tool for peace’

  • Science & Tech

    The “Over & Over Again” exhibition at Pennsylvania State University’s HUB Galleries bridges the gap between science and art.penn state university news

Search

Categories

  • All (1,243)
  • Animal Food (23)
  • Books & Novels (24)
  • Buying Guides (31)
  • Buying Guides (21)
  • Donation and Services (7)
  • Export Test (21)
  • Fashion (1,747)
  • Fashis (1)
  • Fitness & Health (20)
  • Food & Drinks (19)
  • Gift Guides (23)
  • Gift Guides (52)
  • Health & Beauty (22)
  • Health & Beauty (1,614)
  • Home&Living (232)
  • Marketing & Safety Solutions (3)
  • Mobility & Lifestyle (9)
  • Movies (1)
  • Non classifié(e) (2)
  • Nutritional Innovation (4)
  • Photo Gifts (1)
  • Price Comparison (1)
  • Science & Tech (1,345)
  • Science & Tech (1)
  • Sports (33)
  • Technology (183)
  • Travel & Lifestyle (1,724)
  • Travel & Lifestyle (17)
logo

Goevry is not just another run-of-the-mill magazine; it's a transformative journey that transcends the boundaries of traditional fashion publications. Our team of passionate experts, seasoned fashionistas, and visionary writers collaborate to curate a diverse range of thought-provoking features that delve into the very essence of style, culture, and identity.

  • Recent

  • Popular

  • Un marchio di bottiglie eleganti e sostenibili, pensato per l’idratazione quotidiana, l’espressione personale e uno ...

    By techsmillion
    July 4, 2026
  • Il tuo punto di riferimento online di fiducia per salute, bellezza e benessere

    By techsmillion
    July 3, 2026
  • A Homecoming Story, An Original Documentary Featuring Giannis Antetokounmpo

    By admin1
    January 17, 2024
  • This Is Your Brain on Math: The Science Behind Culturally Responsive Instruction

    By admin1
    November 17, 2023

Follow us

  • DMCA
  • Privacy Policy
  • About Us
  • Contacts
©2024 Copyright Goevry | All Rights Reserved.
We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.OkPrivacy policy